Abbreviation
Recombinant Human CD79A protein, partial (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CD79A at 2 μg/mL can bind Anti-CD79A recombinant antibody(CSB-RA004957MA1HU). The EC50 is 1.521-1.700 ng/mL.
Alternative Names
B-cell antigen receptor complex-associated protein alpha chain; Ig-alpha;MB-1 membrane glycoprotein; Membrane-bound immunoglobulin-associated protein; Surface IgM-associated protein; CD79a
Species
Homo sapiens (Human)
Expression Region
33-143aa
Target Protein Sequence
LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNR
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CD79A at 2 μg/ml can bind Anti-CD79A recombinant antibody(CSB-RA004957MA1HU). The EC50 is 1.521-1.700 ng/mL.
Description
CD79A forms the signaling component of the B-cell receptor complex and is a validated target for therapeutic antibodies in B-cell malignancies, making reliable extracellular domain proteins essential for antibody development workflows. This mammalian-expressed construct spanning residues 33–143 demonstrates quantifiable antibody-binding activity with an EC50 of 1.521–1.700 ng/mL in functional ELISA, providing a validated reagent for therapeutic antibody epitope mapping, competitive inhibition screening, and blocking antibody characterization. The mammalian expression system supports native glycosylation and disulfide bond formation critical for conformational epitope presentation, enabling accurate affinity measurements by surface plasmon resonance or biolayer interferometry in drug discovery campaigns targeting CD79A. With greater than 90% purity and endotoxin levels below 1.0 EU/μg, this protein meets the quality thresholds commonly required for ligand-binding assays and serves as a positive control in receptor-ligand interaction studies relevant to B-cell immunology and oncology research.
