Recombinant Mycobacterium tuberculosis Immunogenic protein MPT64 (mpt64)

CSB-BP358713FSGc7
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$528
Quantity:
Express system: Baculovirus
Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Tag Info: C-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
mpt64
Uniprot NO.
Research Area
Others
Species
Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Source
Baculovirus
Expression Region
24-228aa
Target Protein Sequence
APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA
Mol. Weight
23.5
Protein Length
Full Length of Isoform 2
Tag Info
C-terminal 6xHis-tagged
Buffer
Tris-based buffer,50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description

Customer Reviews and Q&A

 Customer Reviews

Target Background

Gene References into Functions
  1. Aptamers against Mtb secreted protein MPT64 were successfully selected and could be used as an alternative for detection and diagnosis of tuberculosis. PMID:28454652
  2. we found that polymorphisms of the mpt64 gene in the MTBC may be the reason for changes in the antigen produced, which may in turn cause alterations of related functions, thereby allowing immune evasion. PMID:23390287
  3. CFP21 (cutinase precursor) and MPT64 fusion protein stimulate higher level of interferon (IFN)-gamma in tuberculin skin test (TST)-positive healthy population than in TST-negative healthy population. PMID:21340709
  4. Data show that Recombinant Mycobacterium vaccae secreted MPT64 could induce high level humoral and cell mediated immune responses in mice and could be used as a candidate of new vaccine against TB. PMID:19257983
  5. Recombinant rMPT64 elicits a specific immune response indistinguishable from that of MPB64 purified from BCG Tokyo culture filtrates. PMID:16216527

Show More

Hide All

Subcellular Location
Secreted.
Database Links

KEGG: mtu:Rv1980c

STRING: 83332.Rv1980c

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products