Recombinant Mycobacterium tuberculosis Immunogenic protein MPT64 (mpt64)

CSB-YP358713FSG
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$436
Quantity:
Express system: Yeast
Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Tag Info: N-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
mpt64
Uniprot NO.
Species
Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Source
Yeast
Expression Region
24-228aa
Target Protein Sequence
APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA
Mol. Weight
24.4kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Buffer
Tris-based buffer,50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP358713MVZ could indicate that this peptide derived from Yeast-expressed Mycobacterium tuberculosis mpt64.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP358713MVZ could indicate that this peptide derived from Yeast-expressed Mycobacterium tuberculosis mpt64.
Description

The cDNA fragment encoding 24-228aa of Mycobacterium tuberculosis immunogenic protein MPT64 was fused with an N-terminal 6xHis-tag and then expressed in the yeast cells. The product obtained is the recombinant full-length of mature Mycobacterium tuberculosis MPT64 protein. Its purity was determined using SDS-PAGE and reached up to 90%. Under the reducing conditions, the gel presented a molecular mass band of about 21-24 kDa. It also underwent the validation through the LC-MS/MS analysis. In-stock MPT64 proteins are offered now. This recombinant MPT64 protein may find uses in the specific antibody production or the studies of tuberculosis (TB) infection.

The level of expression of the MPT64 protein is high in patients with active TB. Both in sputum and serum exosomes of a TB infected patient can be detected the presence of MPT64. A special receptor, single-stranded DNA (ssDNA) aptamer, can specifically recognize MPT64 protein. MPT64 mainly promotes survival and persistence in the host cell. It deactivates the expression of apoptotic cytokines and plays a major role in the survival and virulence of the mycobacteria.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Gene References into Functions
  1. Aptamers against Mtb secreted protein MPT64 were successfully selected and could be used as an alternative for detection and diagnosis of tuberculosis. PMID:28454652
  2. we found that polymorphisms of the mpt64 gene in the MTBC may be the reason for changes in the antigen produced, which may in turn cause alterations of related functions, thereby allowing immune evasion. PMID:23390287
  3. CFP21 (cutinase precursor) and MPT64 fusion protein stimulate higher level of interferon (IFN)-gamma in tuberculin skin test (TST)-positive healthy population than in TST-negative healthy population. PMID:21340709
  4. Data show that Recombinant Mycobacterium vaccae secreted MPT64 could induce high level humoral and cell mediated immune responses in mice and could be used as a candidate of new vaccine against TB. PMID:19257983
  5. Recombinant rMPT64 elicits a specific immune response indistinguishable from that of MPB64 purified from BCG Tokyo culture filtrates. PMID:16216527

Show More

Hide All

Subcellular Location
Secreted.
Database Links

KEGG: mtu:Rv1980c

STRING: 83332.Rv1980c

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products