Home
Product
Protein
Recombinant Proteins
Recombinant Mouse Interleukin-18-binding protein (Il18bp)

Recombinant Mouse Interleukin-18-binding protein (Il18bp)

CSB-RP167694m

Rate （N/A）
Review （0）

Size:

20μg100μg1mg(1mg*1 or 500ug*2)

US$306

Quantity:

Express system: E.coli

Species: Mus musculus (Mouse)

Tag Info: N-terminal 6xHis-tagged

Send an Inquiry

Start an on-line Chat

Orders can only be placed from within the U.S.

Promotion

Transmembrane Protein Questionnaire with Gifts

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Il18bp

Uniprot NO.

Q9Z0M9

Research Area

Others

Alternative Names

Interferon gamma-inducing factor-binding protein

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

29-193aa

Target Protein Sequence

TSAPQTTATVLTGSSKDPCSSWSPAVPTKQYPALDVIWPEKEVPLNGTLTLSCTACSRFPYFSILYWLGNGSFIEHLPGRLKEGHTSREHRNTSTWLHRALVLEELSPTLRSTNFSCLFVDPGQVAQYHIILAQLWDGLKTAPSPSQETLSSHSPVSRSAGPGVA

Mol. Weight

22.0kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Description

To produce recombinant Mouse Il18bp protein, a well-established recombinant DNA technology is the key. A DNA template of Il18bp was constructed with N-terminal 6xHis tag using the technique. Once the template was made, the recombinant Mouse Il18bp protein could be produced with it efficiently. CUSABIO has built a strict QC system to ensure quality. The expression region is 29-193aa of the Mouse Il18bp. The purity of this recombinant is 90% determined by SDS-PAGE.

Il18bp (Igifbp) is a protein coding gene that encodes Interleukin-18-binding protein. According to some studies, Il18bp may have the following features.
IL1R9 is evolutionarily related to IL18BP and may function as an IL-18 receptor. Plasma levels of IL18/IL18BP were elevated during the active stage of the disease, suggesting that it may play a role in the pathogenesis and process of ITP. Myocardial ischemia is a target of IL18BP, and the use of IL18BP may therefore reduce ischemia-induced myocardial dysfunction. All IL18BPs use a conserved inhibitory mechanism by blocking a putative receptor binding site on IL18, but the interface on IL18 can be altered by the broad and diverse family of mammalian and poxvirus IL18BPs.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function

Binds to IL-18 and inhibits its activity. Functions as an inhibitor of the early TH1 cytokine response.

Gene References into Functions

IL-18BP ameliorates cardiac ischemia/reperfusion injury in part through suppression of Th17 differentiation. PMID:26340315
Data show that IL-18bp acts as a sensor for IFN-gamma and can regulate both Th1 and Th17 responses in the CNS. PMID:20644165
Administratioan of murine IL-18BP at the time of the booster injection of bovine CII reduces the progressive severity of collagen-induced arthritis; both clinical disease activity and histological scores are decreased by 50%. PMID:12574381
functional polarization of Ag-specific CD4(+) Th2 cells entering the CNS during the accelerating phase of experimental autoimmune encephalomyelitis is flexible and dependent on IL-18, which is overturned by IL-18 binding protein PMID:15778395
IL-18 and IL-18BP may have roles in testicular development, and also in the regulation of testicular functions under physiological conditions PMID:18299271
A single intravenous dose of recombinant mouse IL18BP decreased neointimal hyperplasia and improved arterial L/A ratios in an atherosclerotic balloon-injury animal model. PMID:18455646