Recombinant Mouse Interleukin-18-binding protein (Il18bp)

CSB-RP167694m
Size:
20μg
20μg100μg1mg(1mg*1 or 500ug*2)
US$306
Quantity:
Express system: E.coli
Species: Mus musculus (Mouse)
Tag Info: N-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.
Promotion

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Il18bp
Uniprot NO.
Research Area
Others
Alternative Names
Interferon gamma-inducing factor-binding protein
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
29-193aa
Target Protein Sequence
TSAPQTTATVLTGSSKDPCSSWSPAVPTKQYPALDVIWPEKEVPLNGTLTLSCTACSRFPYFSILYWLGNGSFIEHLPGRLKEGHTSREHRNTSTWLHRALVLEELSPTLRSTNFSCLFVDPGQVAQYHIILAQLWDGLKTAPSPSQETLSSHSPVSRSAGPGVA
Mol. Weight
22.0kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description

To produce recombinant Mouse Il18bp protein, a well-established recombinant DNA technology is the key. A DNA template of Il18bp was constructed with N-terminal 6xHis tag using the technique. Once the template was made, the recombinant Mouse Il18bp protein could be produced with it efficiently. CUSABIO has built a strict QC system to ensure quality. The expression region is 29-193aa of the Mouse Il18bp. The purity of this recombinant is 90% determined by SDS-PAGE.

Il18bp (Igifbp) is a protein coding gene that encodes Interleukin-18-binding protein. According to some studies, Il18bp may have the following features.
IL1R9 is evolutionarily related to IL18BP and may function as an IL-18 receptor. Plasma levels of IL18/IL18BP were elevated during the active stage of the disease, suggesting that it may play a role in the pathogenesis and process of ITP. Myocardial ischemia is a target of IL18BP, and the use of IL18BP may therefore reduce ischemia-induced myocardial dysfunction. All IL18BPs use a conserved inhibitory mechanism by blocking a putative receptor binding site on IL18, but the interface on IL18 can be altered by the broad and diverse family of mammalian and poxvirus IL18BPs.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function
Binds to IL-18 and inhibits its activity. Functions as an inhibitor of the early TH1 cytokine response.
Gene References into Functions
  1. IL-18BP ameliorates cardiac ischemia/reperfusion injury in part through suppression of Th17 differentiation. PMID:26340315
  2. Data show that IL-18bp acts as a sensor for IFN-gamma and can regulate both Th1 and Th17 responses in the CNS. PMID:20644165
  3. Administratioan of murine IL-18BP at the time of the booster injection of bovine CII reduces the progressive severity of collagen-induced arthritis; both clinical disease activity and histological scores are decreased by 50%. PMID:12574381
  4. functional polarization of Ag-specific CD4(+) Th2 cells entering the CNS during the accelerating phase of experimental autoimmune encephalomyelitis is flexible and dependent on IL-18, which is overturned by IL-18 binding protein PMID:15778395
  5. IL-18 and IL-18BP may have roles in testicular development, and also in the regulation of testicular functions under physiological conditions PMID:18299271
  6. A single intravenous dose of recombinant mouse IL18BP decreased neointimal hyperplasia and improved arterial L/A ratios in an atherosclerotic balloon-injury animal model. PMID:18455646

Show More

Hide All

Subcellular Location
Secreted.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products