Recombinant Mouse Interferon epsilon (Ifne)

Mammalian cell

Code
MSDS	MSDS Datasheet
Size	Pls inquire
Source
Conjugate
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Abbreviation

Ifne

Purity

>85% (SDS-PAGE)

Target Names

Ifne

Uniprot NO.

Q80ZF2

Research Area

Others

Alternative Names

Ifne; Ifne1; Ifnt1Interferon epsilon; IFN-epsilon; Interferon epsilon-1; Interferon tau-1

Species

Mus musculus (Mouse)

Source

Baculovirus

Expression Region

22-192aa

Target Protein Sequence

LEPKRIPFQLWMNRESLQLLKPLPSSSVQQCLAHRKNFLLPQQPVSPHQYQEGQVLAVVHEILQQIFTLLQTHGTMGIWEENHIEKVLAALHRQLEYVESLGGLNAAQKSGGSSAQNLRLQIKAYFRRIHDYLENQRYSSCAWIIVQTEIHRCMFFVFRFTTWLSRQDPDP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

22kD

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Type I interferon required for maintaining basal levels of IFN-regulated genes, including 2'-5'-oligoadenylate synthetase, IRF7 and ISG15, in the female reproductive tract. Directly mediates protection against viral, including HSV-2, and bacterial, including Chlamydia muridarum, genital infections.

Gene References into Functions

IFN-epsilon is constitutively expressed by cells of the reproductive tract and is inefficiently secreted by fibroblasts and cell lines. PMID:23951133
IFN-epsilon could promote migration of antigen-specific CD8(+)T cells to the gut. PMID:22617838
Ifn-epsilon-deficient mice had increased susceptibility to infection of the female reproductive tract by the common sexually transmitted infections (STIs) herpes simplex virus 2 and Chlamydia muridarum. PMID:23449591
interactions between estradiol and IFN-tau in the context of the overall immune response during autoimmune orchitis PMID:21787220

Hide All

Subcellular Location

Secreted.

Protein Families

Alpha/beta interferon family

Tissue Specificity

Expressed at very high levels in uterus and, at much lower levels, in ovary and cervix. Very low levels, if any, in other organs. In the endometrium, expressed in the luminal and glandular epithelial cells (at protein level).

Database Links

UNIGENE: Mm.246593

KEGG: mmu:230405

STRING: 10090.ENSMUSP00000059199

Promotions