Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
G1P2; hUCRP; IFI 15; IFI15; Interferon alpha inducible protein; Interferon induced protein 15; Interferon induced protein IFI-15K; Interferon stimulated protein 15 kDa; Interferon; alpha-inducible protein (clone IFI-15K); Interferon-induced 15 kDa protein; Interferon-induced 17 kDa protein; Interferon-induced 17-kDa/15-kDa protein; IP17; ISG 15; ISG15; ISG15 ubiquitin like modifier; ISG15_HUMAN; Ubiquitin cross-reactive protein; Ubiquitin-like protein ISG15; UCRP
Species
Homo sapiens (Human)
Expression Region
2-157aa
Target Protein Sequence
AWDLKVKMLGGNDFLVSVTNSMTVSELKKQIAQKIGVPAFQQRLAHQTAVLQDGLTLSSLGLGPSSTVMLVVQNCSEPLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQFWLSFEGRPMEDKELLGEYGLKPQCTVIKHLRLRGGGG
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Discover the superior quality of our Recombinant Human Isg15 protein, meticulously engineered for researchers focused on immunology. This full-length Ubiquitin-like protein ISG15 (Interferon-induced 15 kDa protein; Interferon-induced 17 kDa protein) is expressed in an E.coli system, covering the 2-157aa expression region to deliver the complete mature protein for your research needs. To facilitate purification and detection, the Isg15 protein features an N-terminal GST tag, ensuring consistent performance and reliable results in your experiments.
With a purity greater than 90% as determined by SDS-PAGE, our Recombinant Human Isg15 protein is available in both liquid and lyophilized powder forms. Trust in this high-quality protein to support your immunology research and provide dependable, reproducible outcomes.