Recombinant Human Ubiquitin-like protein ISG15 (ISG15)

In Stock
Code: CSB-YP011843HU
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$250
Quantity:
Express system: Yeast
Species: Homo sapiens (Human)
Tag Info: N-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
ISG15
Uniprot NO.
Research Area
Immunology
Alternative Names
Interferon-induced 15 kDa protein Interferon-induced 17 kDa protein Short name: IP17 Ubiquitin cross-reactive protein Short name: hUCRP
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
2-157aa
Target Protein Sequence
GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
18.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Ubiquitin-like protein which plays a key role in the innate immune response to viral infection either via its conjugation to a target protein (ISGylation) or via its action as a free or unconjugated protein. ISGylation involves a cascade of enzymatic reactions involving E1, E2, and E3 enzymes which catalyze the conjugation of ISG15 to a lysine residue in the target protein. Its target proteins include IFIT1, MX1/MxA, PPM1B, UBE2L6, UBA7, CHMP5, CHMP2A, CHMP4B and CHMP6. Isgylation of the viral sensor IFIH1/MDA5 promotes IFIH1/MDA5 oligomerization and triggers activation of innate immunity against a range of viruses, including coronaviruses, flaviviruses and picornaviruses. Can also isgylate: EIF2AK2/PKR which results in its activation, DDX58/RIG-I which inhibits its function in antiviral signaling response, EIF4E2 which enhances its cap structure-binding activity and translation-inhibition activity, UBE2N and UBE2E1 which negatively regulates their activity, IRF3 which inhibits its ubiquitination and degradation and FLNB which prevents its ability to interact with the upstream activators of the JNK cascade thereby inhibiting IFNA-induced JNK signaling. Exhibits antiviral activity towards both DNA and RNA viruses, including influenza A, HIV-1 and Ebola virus. Restricts HIV-1 and ebola virus via disruption of viral budding. Inhibits the ubiquitination of HIV-1 Gag and host TSG101 and disrupts their interaction, thereby preventing assembly and release of virions from infected cells. Inhibits Ebola virus budding mediated by the VP40 protein by disrupting ubiquitin ligase activity of NEDD4 and its ability to ubiquitinate VP40. ISGylates influenza A virus NS1 protein which causes a loss of function of the protein and the inhibition of virus replication. The secreted form of ISG15 can: induce natural killer cell proliferation, act as a chemotactic factor for neutrophils and act as a IFN-gamma-inducing cytokine playing an essential role in antimycobacterial immunity. The secreted form acts through the integrin ITGAL/ITGB2 receptor to initiate activation of SRC family tyrosine kinases including LYN, HCK and FGR which leads to secretion of IFNG and IL10; the interaction is mediated by ITGAL.
Gene References into Functions
  1. These results demonstrate that virus-induced IFN-lambda4 potently blocks IFN-alpha signalling by inducing high protein levels of ISG15 and USP18. Moreover, the data clearly demonstrate that DAA therapy restores IFN-alpha responsiveness in HCV-infected cells. PMID:28630501
  2. IFN-gamma increases free ISG15 levels in the cytoplasm and ISGylation in the nucleus and cytoplasm, but in a manner distinct between MCF-7 and MDA-MB-231cells. PMID:29626479
  3. Hepatitis E virus may promote production of IFN-alpha/beta and expression of ISG15 via ORF3 in the early stages, and increased ISG15 subsequently inhibited the production of IFN-alpha/beta. PMID:29853735
  4. ISGylation is a ubiquitin-like modification that controls exosome release. ISGylation induction decreases microvesicular body numbers and impairs exosome secretion. Specifically, ISGylation of the MVB protein TSG101 induces its aggregation and degradation, being sufficient to impair exosome secretion. PMID:27882925
  5. The species-specific gain-of-function in antiviral immunity observed in ISG15 deficiency is explained by the requirement of ISG15 to sustain USP18 levels in humans. PMID:27193971
  6. HIV-1 IIIB infection of myeloid ThP-1 cells also reduced the IFN-alpha-mediated induction of the anti-viral gene, ISG15, but not MxA, revealing a functional consequence of this HIV-1-mediated immune evasion strategy. PMID:29580840
  7. DNA damage induces ISG15 conjugation to p53 and this modification markedly enhances the binding of p53 to the promoters of its target genes as well as of its own gene by promoting phosphorylation and acetylation. PMID:27545325
  8. Studied foot-and-mouth disease virus (FMDV) Lbpro targeting of ISG15. Show a previously undescribed mechanism by which viruses interfere with the ubiquitin and ubiquitin-like systems. PMID:29463763
  9. ISG15 is able to trigger IFN-gamma production and other signaling pathways suggesting it is a potential cytokine that could interact with still unknown receptors. (Review) PMID:28467275
  10. ISG15 induces cancer cell apoptosis by disrupting the NF-kappaB signaling pathway. This study highlighted a novel role of ISG15 in tumor suppression. PMID:27659523
  11. The Interferon-stimulated 15-KDa protein (ISG15) rs1921 variant and ISG15 expression are associated with HBV-related liver diseases. PMID:27626177
  12. findings revealed that MERS-CoV PLpro chiefly engages human ISG15 through its C-terminal domain; structure of MERS-CoV PLpro was solved to 2.4 A in complex with the C-terminal domain of hISG15; structure of MERS-CoV PLpro in complex with this domain exposed the interface between these two entities PMID:28931677
  13. Our study demonstrates a protumor role of ISG15, and suggests that ISG15 is a prognostic predictor and a potential therapeutic target for nasopharyngeal carcinoma PMID:26919245
  14. Results show that HERC5 mediates covalent ISG15 conjugation to parkin in mammalian cells and that ISG15 is conjugated to the Lys349 and Lys369 residues of parkin which increases its ubiquitin E3 ligase activity. PMID:27534820
  15. Extracellular ISG15 signals cytokine secretion through the LFA-1 integrin receptor (CD11a/CD18) in natural killer cells. PMID:29100055
  16. Results suggest that unconjugated ISG15 affects the functions of HCV NS5A through protein-protein interaction. PMID:28543875
  17. This report demonstrates that ISG15 induced by Hepatitis E virus replication in Huh7-S10-3 human liver cells plays an immunomodulatory role by negatively regulating type I Interferon signaling and, thus, Hepatitis E virus sensitivity to type I Interferon. PMID:28724761
  18. epletion of either ISG15 or UBE2L6/UBCH8 resulted in enhanced endogenous autophagic flux. PMID:28186990
  19. unlike ISG15, ubiquitin and FAT10 are conjugated to a similar degree to newly translated and pre-existing proteins. PMID:27926780
  20. This paper shows that ISG15 directly regulates Human Cytomegalovirus replication and that its accumulation restricts productive virus growth. PMID:28202760
  21. The results suggest that integrin-adhesion-induced MRTF-A-SRF activation and ISG15 expression constitute a newly discovered signaling circuit that promotes cell migration and invasion. PMID:26872785
  22. These data indicate that hepatic expression of PSMA6, which is upregulated during viral hepatitis, likely depends on TLR3 activation and, that PSMA6 affects the expression of immunoregulatory ISG15, a proviral factor in the pathogenesis of hepatitis C virus infection. PMID:26833585
  23. ISG15 dysregulation may be involved in the pathogenesis of glomerular inflammation PMID:26844778
  24. This study shows that interferon-stimulated gene 15 (ISG15) lowers Human respiratory syncytial virus growth through protein ISGylation. PMID:26763998
  25. Data show the induction of signal transducer and activator of transcription (STAT)1 and IFN-stimulated gene 15 protein (ISG15) in Rickettsia conorii-infected human umbilical vein endothelial cells (HUVECs). PMID:26560068
  26. ISG15 might serve as a novel prognostic biomarker in drinkers with esophageal squamous cell cancer PMID:26617815
  27. Cellular ubiquitin is a substrate of ISG15 and Lys 29 on ubiquitin is the major ISG15 acceptor site. PMID:26226047
  28. Microparticles released from Mycobacterium tuberculosis-infected human macrophages contain increased levels of the type I interferon inducible protein ISG15. PMID:26036210
  29. The inhibitory effect of ISG15 on HCV RNA replication does not require its conjugation to substrates by HERC5. PMID:26361997
  30. These data reveal a previously uncharacterized ISG15-dependent restriction of Listeria infection, reinforcing the view that ISG15 is a key component of the innate immune response. PMID:26259872
  31. free ISG15 may have antitumor and immunoregulatory function in vivo in breast cancer PMID:25749047
  32. Propose that Isg15-dependent degradation of p53 represents an alternative mechanism of controlling p53 protein levels, and, thus, it is an attractive pathway for drug discovery. PMID:24844324
  33. Reovirus T3D infection induced STAT-1, ISG-15, IFIT-1, Mx1, and IFIT-3 expression. PMID:25905045
  34. Results suggest that high ISG15 expression is an intrinsic feature of hepatocellular carcinoma and a trigger for tumorigenesis and metastasis. PMID:25238261
  35. our work demonstrates that ISG15 is a previously unrecognized support factor for CSC in the PDAC microenvironment with a key role in pathogenesis and progression. PMID:25368022
  36. intracellular ISG15 is IFN-alpha/beta-inducible not to serve as a substrate for ISGylation-dependent antiviral immunity, but to ensure USP18-dependent regulation of IFN-alpha/beta and prevention of IFN-alpha/beta-dependent autoinflammation PMID:25307056
  37. The ISG15 conjugation system represents a critical innate response mechanism in cardiomyocytes to fight the battle against invading pathogens, limiting inflammatory cardiomyopathy, heart failure, and death. PMID:25165091
  38. suppression of ISG15 by siRNA sensitized A549-CUG2 cells to vesicular stomatitis virus infection. PMID:24452380
  39. ISG15 does not appear to play a key role in IFN-beta-mediated C2C12 myoblast cell fusion PMID:23750257
  40. ISG15 is a potential prognostic marker in high-grade serous carcinoma of the ovary PMID:24300530
  41. Results showed that ISG15 modification (ISGylation) of PCNA plays a key role in translesion DNA synthesis termination. PMID:24768535
  42. These data support the interferon-induced generation of a Tsg101- and ISG15-dependent checkpoint in the secretory pathway that compromises influenza virus release. PMID:24237697
  43. Findings support the development of ISG15 conjugation inhibitors for treating breast and also other cancers expressing oncogenic Ki-Ras. PMID:23318454
  44. expression of the ISG15 and/or ISGylation system attenuates HIF-1alpha-mediated gene expression and tumorigenic growth. PMID:24056783
  45. ISG15 is counteracted by vaccinia virus E3 protein and controls the proinflammatory response against viral infection. PMID:24257616
  46. Our results suggest that ISG15 overexpression could be developed into a powerful gene-therapeutic tool for treating IFN-alpha-resistant HCC. PMID:24024201
  47. HIV-1 infection up-regulating expression of ISG15 in cell lines. PMID:24386835
  48. High interferon-stimulated gene ISG-15 expression affects HCV treatment outcome in patients co-infected with HIV and HCV. PMID:23588721
  49. Activation of double-stranded RNA-activated protein kinase (PKR) by interferon-stimulated gene 15 (ISG15) modification down-regulates protein translation PMID:23229543
  50. ISG15 deregulates autophagy in genotoxin-treated ataxia telangiectasia cells PMID:23212917

Show More

Hide All

Subcellular Location
Cytoplasm. Secreted. Note=Exists in three distinct states: free within the cell, released into the extracellular space, or conjugated to target proteins.
Tissue Specificity
Detected in lymphoid cells, striated and smooth muscle, several epithelia and neurons. Expressed in neutrophils, monocytes and lymphocytes. Enhanced expression seen in pancreatic adenocarcinoma, endometrial cancer, and bladder cancer, as compared to non-c
Database Links

HGNC: 4053

UNIGENE: Hs.458485

KEGG: hsa:9636

STRING: 9606.ENSP00000368699

OMIM: 147571

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products