Recombinant Human Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A), partial

Code: CSB-MP023977HU1n6
Size:
20ug
20ug100ug1mg
US$98
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: C-terminal Twin-Strep-Avi-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human TNFRSF1A protein, partial
Purity
Greater than 95% as determined by SDS-PAGE.
Target Names
TNFRSF1A
Uniprot NO.
Research Area
Apoptosis
Alternative Names
Tumor necrosis factor receptor 1;TNF-R1;Tumor necrosis factor receptor type I;TNF-RI;TNFR-I;p55;p60;CD antigen CD120a;TBPI
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
22-211aa
Target Protein Sequence
IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.4 kDa
Protein Length
Partial
Tag Info
C-terminal Twin-Strep-Avi-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase.
Gene References into Functions
  1. Elevated TNFRs levels were associated with the risk of cardiovascular and/or all-cause mortality independent of all relevant covariates in patients undergoing haemodialysis PMID:28256549
  2. It has been demonstrated that the molecular genetic marker +36G TNFR1 (OR=1,25) is involved in the formation Essential Hypertension in individuals with Metabolic Syndrome. PMID:30289218
  3. Due to the fact that the mutation was not inherited from the parents, it was likely that R426L was a de novo and novel mutation in the TNFRSF1A gene, which can trigger TRAPS or TRAPS-like symptoms. PMID:27793577
  4. this study evaluated TNFR1 -609G/T polymorphisms association with RA susceptibility in a sample of Mexican patients. Our results suggest that the TNFR1 -609G/T polymorphisms are not associated with RA susceptibility in a sample of Mexican patients. PMID:29404828
  5. Polymorphisms in the TNFR1 gene may have an impact on the symptomatology of schizophrenia in men. rs4149577 and rs1860545 SNPs were associated with the intensity of the Positive and Negative Syndrome Scale (PANSS) excitement symptoms in men, which may contribute to the risk of violent behavior. PMID:29317797
  6. Polymorphism of Promoter Region of TNFRSF1A Gene is associated with Radiotherapy Induced Oral Mucositis in Head and Neck Cancer. PMID:28401452
  7. five single nucleotide polymorphisms in the TNFRSF1A gene are not associated with autoimmune thyroid diseases in the Chinese Han population, but rs4149570 shows a weak association with Hashimoto's thyroiditis after adjusting for gender and age. PMID:29401539
  8. Genotype rs767455 was associated with the susceptibility of ankylosing spondylitis(AS), G allele of rs767455 exhibited an association with the risk of developing AS. Only rs1061622 was significantly associated with long-term efficacy of etanercept. The results suggest that TNFRSF1A and TNFRSF1B polymorphisms were associated with susceptibility, severity, and the long-term therapeutic efficacy of etanercept of AS patients. PMID:30075559
  9. RACK1 associates with MOAP-1 via electrostatic associations similar to those observed between MOAP-1/RASSF1A and MOAP-1/TNF-R1. These events illustrate the complex nature of MOAP-1 regulation and characterizes the important role of the scaffolding protein, RACK1, in influencing MOAP-1 biology. PMID:29470995
  10. serum level did not decrease significantly after tonsillectomy with steroid pulse therapy in IgA nephropathy PMID:28389814
  11. The TNFRSF1A c.625+10 G allele was associated with late response to anti-TNFalpha therapy but TNFRSF1A gene SNPs is not associated with spondyloarthritis. PMID:29579081
  12. TNFR1 is associated longitudinally with kidney function decline but not with myocardial infarct, heart failure, or mortality risk after adjustment PMID:28601698
  13. One third of our childhood MS patients had a heterozygous mutation in the TNFRSF1A and/or MEFV gene. This proportion by far exceeds the number of mutations expected and was higher than in adult MS patients, suggesting that these mutations might contribute to the pathogenesis of childhood MS. PMID:28927886
  14. Studied the association of NLR family pyrin domain containing 3 (NLRP3) and tumor necrosis factor receptor superfamily member 1A (TNFRSF1A) polymorphisms and haplotypes in patients with ankylosing spondylitis (AS) and treatment response to etanercept. PMID:28116820
  15. Investigations of underlying molecular mechanisms of TNFR1 signaling showed that PDF affects TNFR1 signaling at the proapoptotic signaling pathway by upregulation of IkappaBalpha and downregulation of cFLIPL. PMID:28096440
  16. Case Report: tumor necrosis factor receptor-associated periodic syndrome due to the R92Q TNFRSF1A variant associated with recurrent pericarditis and cardiac tamponade. PMID:27990755
  17. Serum TNFR1 is a biomarker for patients with chronic kidney disease. PMID:28667032
  18. This study demonstrated that TNFR1 expression levels are related to major depressive disorder and conjunctly mediate the effect of childhood maltreatment history on the risk of developing major depressive disorder. PMID:28384542
  19. SNP (36A>G) is strong risk factor for odontogenic keratocystic tumor PMID:28199753
  20. Data suggest that Fas and TNFR1 are involved in glaucoma mechanisms in cornea; pro-apoptotic effect of anti-glaucoma medication clonidine on corneal epithelial cells triggers Fas/TNFR1-mediated, mitochondria-dependent signaling pathway. (Fas = Fas cell surface death receptor ; TNFR1 = TNF receptor superfamily member 1A) PMID:28115640
  21. These results indicate that TNFRI-Fc and hHO-1 overexpression may apparently induce free iron in the liver and exert oxidative stress by enhancing reactive oxygen species production and block normal postneonatal liver metabolism. PMID:28503569
  22. Data suggest that elevated serum levels of soluble TNF receptors, especially sTNFR1, are associated with loss of kidney function in Hispanic patients with diabetes type 2 in Colombia. PMID:27068267
  23. Case Report: heterozygous missense variants in TNFRSF1A identified in family members with familial Mediterranean fever. PMID:29148404
  24. Case Report: autoinflammatory syndrome with relapsing aseptic neutrophilic meningitis and chronic myelitis associated with MEFV/TNFRSF1A mutations. PMID:28134085
  25. In this article we will review the role of ubiquitination and proteolysis in these diverse events focusing on our own contributions to the lysosomal apoptotic pathway linked to the subcellular compartmentalization of TNF-R1 PMID:28765050
  26. Coadministration of either ATROSAB or EHD2-scTNFR2 into the magnocellular nucleus basalis significantly protected cholinergic neurons and their cortical projections against cell death, and reverted the neurodegeneration-associated memory impairment in a passive avoidance paradigm. Simultaneous blocking of TNFR1 and TNFR2 signaling, however, abrogated the therapeutic effect PMID:27791020
  27. Data show that interleukin-2 receptor alpha, tumor necrosis factor receptor 1, serum STimulation-2 (IL1RL1 gene product), and regenerating islet-derived 3-alpha were significantly associated with non-relapse mortality. PMID:28126963
  28. Report of a severe case of TRAPS associated with a novel mutation, Thr90Pro, in the TNFRSF1A gene in an infant and several family members. PMID:28427379
  29. atopic dermatits patients had increased TNFR1 expression on immune cells PMID:29212072
  30. Elevated level of soluble tumor necrosis factor receptors 1 and lower level of leptin are associated with higher developmental outcomes in infants between the ages of 6 and 24 months. PMID:28238825
  31. The highest levels of TNFR1 are independently associated with progression of renal disease and death in type 2 diabetic nephropathy. PMID:27003829
  32. High plasma levels of TNFR1 and TNFR2 were associated with incident intracerebral hemorrhage. PMID:28830973
  33. Renal clear cell carcinoma cells cells express increased amounts of RIPK1 and RIPK3 and are poised to undergo necroptosis in response to TNFR1 signaling. PMID:27362805
  34. TRIM28 acts as a central factor in controlling endothelial inflammatory responses and angiogenic activities by retaining expression of TNFR-1 and -2 and VEGF receptor 2 in endothelial cells PMID:28159803
  35. a specific link between the penetrance of the TNFRSF1A mutation and the observed T cell phenotype, is reported. PMID:26598380
  36. Collectively, this study provides more insights into RELT expression, RELT family member function, and the mechanism of RELT-induced death. PMID:28688764
  37. Burkholderia cenocepacia BcaA binds to tumor necrosis factor receptor 1. PMID:27684048
  38. TNFRSF1A variants were identified in 10 tumor necrosis factor receptor-associated periodic syndrome patients from 10 independent families. The T61I variant was found in patients, while the V136M and S321I variants were found in 1 patient each. All the patients were heterozygous for the variants. Among the healthy controls, 7 of 363 individuals were heterozygous for the T61I variant. PMID:27332769
  39. Voxel-based morphometry was used to analyse the associations between TNFRSF1A (rs4149576 and rs4149577) and grey matter structure. Highly significant genotypic associations with striatal volume but not the hippocampus were seen. Specifically, for rs4149576, G homozygotes were associated with reduced caudate nucleus volumes relative to A homozygotes and heterozygotes. Reduced caudate volumes were observed in C homozygotes PMID:27528091
  40. Circulating TNFR1 and 2 were shown to be associated with cardiovascular disease, independent of age, sex, inflammatory markers, and other cardiovascular disease risk factors, in the chronic kidney disease patients PMID:28489742
  41. Infection with C. trachomatis disturbs TNFR1 signalling specifically at the level of receptor internalization. PMID:27062399
  42. Data suggest that TRAF2 (TNF receptor-associated factor 2) negatively regulates (1) TNFR1- (tumor necrosis factor binding protein 1)-induced apoptosis, (2) TNFR2- (tumor necrosis factor receptor type 2)-induced non-canonical NFkappaB signaling, and (3) TNF- (tumor necrosis factor)-induced necroptosis. [REVIEW] PMID:26993379
  43. Our analysis showed that the TNFR1 rs2234649 polymorphism does not increase ankylosing spondylitis risk. In conclusion, the TNFR1 gene polymorphism tested does not appear to be useful for assessing predisposition to ankylosing spondylitis. PMID:28363009
  44. elevated serum level associated with heart failure risk in type 2 diabetes mellitus patients PMID:28367848
  45. The data demonstrate a novel and unexpected function of BIG1 that regulates TNFR1 signaling by targeting TRAF2. PMID:27834853
  46. Data indicate that plasma concentrations of TNFR1 and TNFR2 are elevated in pediatric lupus nephritis. PMID:26854079
  47. TNFR1 is the major pro-inflammatory mediator of TNF-alpha in fibroblast-like synoviocytes (FLS), whereas TNFR2, may act as an immunosuppressor in FLS for the prevention of overwhelming inflammatory reactions. PMID:28150360
  48. Results suggest that miR-29a is an important regulator of tumor necrosis factor receptor 1 expression in breast cancer and functions as a tumor suppressor by targeting tumor necrosis factor receptor 1 to influence the growth of MCF-7 cell. PMID:28222663
  49. Serum sTNFR1 and sTNFR2 are associated with obese girls but not obese boys, thereby suggesting that serum sTNFRs in early childhood obesity may be sex related. PMID:27040725
  50. SCCAg, CYFRA 21.1, IL-6, VEGF and sTNF receptors have roles in squamous cell cervical cancer PMID:26289850

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein. Golgi apparatus membrane; Single-pass type I membrane protein. Secreted. Note=A secreted form is produced through proteolytic processing.; [Isoform 4]: Secreted. Note=Lacks a Golgi-retention motif, is not membrane bound and therefore is secreted.
Database Links

HGNC: 11916

UNIGENE: Hs.279594

KEGG: hsa:7132

STRING: 9606.ENSP00000162749

OMIM: 142680

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products