Abbreviation
Recombinant Human TNFRSF1A protein, partial (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized TNF-α (CSB-YP023955HU) at 5 μg/ml can bind human TNFR1, the EC50 is 7.799-10.90 ng/ml.②Measured by its binding ability in a functional ELISA. Immobilized LTA(CSB-MP013218HU) at 5 μg/ml can bind human TNFR1, the EC50 is 4.409-6.797 ng/ml.
Alternative Names
(TNF-R1)(Tumor necrosis factor receptor type I)(TNF-RI)(TNFR-I)(p55)(p60)(CD120a)(TNFAR)(TNFR1)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
22-211aa
Target Protein Sequence
IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal hFc1-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized TNF-α (CSB-YP023955HU) at 5 μg/ml can bind human TNFR1, the EC50 is 7.799-10.90 ng/ml.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized LTA(CSB-MP013218HU) at 5 μg/ml can bind human TNFR1, the EC50 is 4.409-6.797 ng/ml.
Description
TNFRSF1A serves as the primary signaling receptor for TNF-α and lymphotoxin-alpha, making its extracellular domain a critical tool for dissecting inflammatory and apoptotic pathway interactions. This recombinant construct spans residues 22–211, encompassing the complete ligand-binding domain, and is expressed in mammalian cells to preserve native disulfide bonding and glycosylation essential for conformational integrity. Functional ELISA validation demonstrates robust binding to both TNF-α (EC50 of 7.8–10.9 ng/ml) and LTA (EC50 of 4.4–6.8 ng/ml), confirming that this protein supports use in ligand-binding interaction assays, competitive inhibition studies, blocking antibody screening, and as a positive control in SPR or BLI affinity characterization experiments. The C-terminal hFc1 tag facilitates oriented immobilization on Protein A surfaces, while purity exceeding 90% and endotoxin levels below 1.0 EU/μg satisfy the criteria typical for drug discovery inhibitor screening and therapeutic antibody epitope mapping.
