Abbreviation
Recombinant Human TNFSF15 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF15 at 2 μg/mL can bind Anti-TNFSF15 recombinant antibody (CSB-RA023992MA1HU). The EC50 is 0.7563-0.8726 ng/mL.
Alternative Names
Tumor necrosis factor ligand superfamily member 15; TNF ligand-related molecule 1; Vascular endothelial cell growth inhibitor [Cleaved into: Tumor necrosis factor ligand superfamily member 15, membrane form; Tumor necrosis factor ligand superfamily member 15, secreted form]
Species
Homo sapiens (Human)
Expression Region
72-251aa
Target Protein Sequence
LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF15 at 2 μg/ml can bind Anti-TNFSF15 recombinant antibody (CSB-RA023992MA1HU). The EC50 is 0.7563-0.8726 ng/mL.
Description
TNFSF15 plays a pivotal role in vascular remodeling and immune regulation, making it a key target in cancer and inflammatory disease research. This recombinant protein, spanning residues 72–251 and expressed in mammalian cells to preserve native glycosylation, demonstrates robust receptor-binding activity with an EC50 of 0.76–0.87 ng/mL in functional ELISA against a specific anti-TNFSF15 antibody, confirming proper folding and epitope presentation. The low endotoxin level (< 1.0 EU/μg) combined with > 95% purity satisfies the stringent criteria expected for cell-based functional assays, including primary T-cell activation studies, endothelial cell apoptosis experiments, and NF-κB signaling pathway investigations where LPS contamination would confound cytokine-specific responses. The validated binding activity supports its use as a coating antigen in ELISA development, a positive control in Western blot validation, and an immunogen for antibody generation targeting the extracellular domain of TNFSF15.
