Abbreviation
Recombinant Human TNFSF15 protein, partial, Biotinylated (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF15 at 2 μg/mL on streptavidin coated plates can bind Anti-TNFSF15 antibody (CSB-RA023992MA1HU). The EC50 is 0.2732 - 0.6370 ng/mL.
Alternative Names
TL1, VEGI
Species
Homo sapiens (Human)
Expression Region
72-251aa
Target Protein Sequence
LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Partial of Isoform 1
Tag Info
N-terminal 10xHis-Avi-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF15 at 2 μg/ml on streptavidin coated plates can bind Anti-TNFSF15 antibody (CSB-RA023992MA1HU). The EC50 is 0.2732 - 0.6370 ng/mL.
Description
TNFSF15 (TL1A) engages death receptor 3 to modulate T cell activation and inflammatory responses, making it a critical target in cancer immunology and autoimmune disease models. This biotinylated variant, spanning residues 72–251 of isoform 1, demonstrates robust receptor-binding activity with an EC50 of 0.27–0.64 ng/mL in functional ELISA against anti-TNFSF15 antibody, confirming proper folding and epitope accessibility for antibody development workflows including immunogen preparation, ELISA coating antigen applications, and positive control validation in Western blot. The N-terminal His-Avi tag enables oriented immobilization on streptavidin surfaces, supporting high-sensitivity binding assays and surface plasmon resonance studies of TNFSF15–receptor interactions. With endotoxin levels below 1.0 EU/μg and purity exceeding 95%, this preparation meets the quality thresholds commonly required for cell-based functional assays examining T cell proliferation, NF-κB or MAPK signaling pathway activation, and apoptosis induction in primary lymphocytes or tumor cell lines.
