Abbreviation
Recombinant Human TSLP protein (R127A,R130A) (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Activity
Measured by its binding ability in a functional ELISA. Immobilized human TSLP(R127A,R130A) at 2 μg/mL can bind Anti-TSLP recombinant antibody(CSB-RA025141MA2HU). The EC50 is 52.55-58.67 ng/mL.
Species
Homo sapiens (Human)
Expression Region
29-159aa(R127A,R130A)
Target Protein Sequence
YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKARKAKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized human TSLP(R127A,R130A) at 2 μg/ml can bind Anti-TSLP recombinant antibody(CSB-RA025141MA2HU). The EC50 is 52.55-58.67 ng/mL.
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
The purity of TSLP was greater than 95% as determined by SEC-HPLC
Description
TSLP drives type 2 immune responses and epithelial–immune crosstalk in allergic inflammation, yet wild-type TSLP's heparin-binding properties can complicate quantitative assays; this R127A/R130A double mutant eliminates glycosaminoglycan interactions while preserving receptor engagement, enabling cleaner dose–response studies. Expressed as the full mature sequence (aa 29–159) in mammalian cells, the protein demonstrates specific antibody binding in functional ELISA with an EC50 of 52.55–58.67 ng/mL, supporting its use as a coating antigen in antibody development workflows, a positive control in TSLP detection assays, and a reference standard for validating anti-TSLP therapeutics. The endotoxin level below 1.0 EU/μg meets the contamination thresholds commonly required for primary human dendritic cell and T cell activation assays, where even trace LPS can trigger artifactual cytokine secretion and obscure TSLP-specific signaling through STAT5 and NF-κB pathways. Purity exceeding 95% by SDS-PAGE provides a suitable basis for quantitative studies of TSLP-driven Th2 polarization and ILC2 expansion.