Recombinant Human Pro-neuregulin-1, membrane-bound isoform (NRG1), partial

Code: CSB-EP016077HU3(F6)
Size:
20ug
20ug100ug1mg
US$224
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: N-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human NRG1 protein, partial
Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
NRG1
Uniprot NO.
Research Area
Neuroscience
Alternative Names
Pro-NRG1;Acetylcholine receptor-inducing activity;ARIA;Breast cancer cell differentiation factor p45;Glial growth factor;Heregulin;HRG;Neu differentiation factor;Sensory and motor neuron-derived factor
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
176-246aa
Target Protein Sequence
TSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAEELYQK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
15.8 kDa
Protein Length
Partial of Isoform 6
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. The multiple isoforms perform diverse functions such as inducing growth and differentiation of epithelial, glial, neuronal, and skeletal muscle cells; inducing expression of acetylcholine receptor in synaptic vesicles during the formation of the neuromuscular junction; stimulating lobuloalveolar budding and milk production in the mammary gland and inducing differentiation of mammary tumor cells; stimulating Schwann cell proliferation; implication in the development of the myocardium such as trabeculation of the developing heart. Isoform 10 may play a role in motor and sensory neuron development. Binds to ERBB4. Binds to ERBB3. Acts as a ligand for integrins and binds (via EGF domain) to integrins ITGAV:ITGB3 or ITGA6:ITGB4. Its binding to integrins and subsequent ternary complex formation with integrins and ERRB3 are essential for NRG1-ERBB signaling. Induces the phosphorylation and activation of MAPK3/ERK1, MAPK1/ERK2 and AKT1. Ligand-dependent ERBB4 endocytosis is essential for the NRG1-mediated activation of these kinases in neurons.
Gene References into Functions
  1. Enhanced ERBB4 phosphorylation could mediate NRG1 effects on mitochondrial function through signalling pathways PMID:28496106
  2. In Autism Spectrum Disorder patients, the NRG1 levels were found to be statistically significantly high compared to the healthy control group. PMID:30150060
  3. COMT-GG and NRG1-AA genotypes aid the transcranial direct current stimulation-induced improvement in auditory verbal hallucinations in schizophrenia patients. PMID:29559020
  4. The neuregulin1 was observed to be cleaved, adding to the 3 known NS3/4A cleavage targets. It showed that NS3/4A triggers an increase in neuregulin1 mRNA levels in HCV infected cells. PMID:29438748
  5. These results support the association between genetic variation of RET and NRG1 and susceptibility to Hirschsprung disease in the Chinese population. PMID:28256518
  6. Results found that NRG1, a potential prognostic marker is highly expressed in papillary thyroid cancer (PTC). Also, further data demonstrate that NRG1 activates the antioxidant pathway by upregulating the expression of antioxidant enzymes through NRF2, thus modulating redox homeostasis in PTC. PMID:29901070
  7. Mesenchymal stem cell-drived paclitaxel resistance in ErbB2/ErbB3-coexpressing breast cancer cells could be attributed to upregulation of Survivin via paracrine effect of NRG-1/ErbB3/PI-3K/Akt signaling, as either specific knockdown expression of ErbB3, or blocking of downstream PI-3K/Akt signaling, or specific inhibition of Survivin can completely reverse this effect. PMID:29715459
  8. The data suggest a role for transcriptional regulation of NRG1 in the predisposition to papillary thyroid carcinoma. PMID:29121253
  9. NRG1rs3924999 and NRG1 rs6994992 are associated with change of temperament scores in a clinical sample of subjects with major depression (MDD), who received selective serotonin reuptake inhibitor treatment. PMID:29310728
  10. NRG1 is a potential prognostic and therapeutic biomarker in gastric cancer patients PMID:28573357
  11. Study found that the protein levels of NRG1 and ErbB4 were significantly increased in the temporal cortex of patients with symptomatic epilepsy. Also, NRG1-ErbB4 signaling suppresses GluN2B phosphorylation by Src inhibition. GluN2B is closely related to synaptic activity and its regulation by the NRG1-ErbB4-Src signaling axis highlights the importance of NRG1-ErbB4 signaling in symptomatic epilepsy pathology. PMID:28273943
  12. Levels of NRG1 type III expression in peripheral blood mononuclear cells were positively correlated with impairments in social interaction in children with autism spectrum disorder. PMID:28089559
  13. NRG1-dependent activation of HER3 induces primary resistance to trastuzumab in HER2-overexpressing breast cancer cells. HER3 monoclonal antibody combined with trastuzumab may serve as a treatment choice for patients with primary resistance to trastuzumab. PMID:29048656
  14. Results represent the first comprehensive investigation of neuregulin-1 (NRG1) isoforms and protein expression in the blood of clozapine-treated schizophrenia patients and suggest levels of some NRG1 transcripts are upregulated in those with schizophrenia. PMID:29225331
  15. HRG/HER2/HER3 signaling promotes AhR-mediated Memo-1 expression and migration in colorectal cancer PMID:27941874
  16. Date indicate the subcellular localization and dynamics post-translational processing, (ectodomain shedding) of neuregulin1 (NRG1). PMID:27364328
  17. NRG1 and Gal-3 were significantly more elevated in cancer patients than in healthy controls. PMID:28430337
  18. The toxicity profile of lumretuzumab in combination with cetuximab and erlotinib was manageable, but only modest clinical activity was observed across tumor types. In the sqNSCLC cohort, there was no evidence of meaningful clinical benefit despite enriching for tumors with higher HRG mRNA expression levels. PMID:28600476
  19. Using time-resolved-fluorescence energy transfer (TR-FRET), we demonstrated that in the presence of recombinant NRG1, binding of 9F7-F11 (a nonligand-competing anti-HER3 antibody) to HER3 is increased, whereas that of ligand-competing anti-HER3 antibodies is decreased. PMID:28507002
  20. Data suggest that SLC3A2-NRG1 should be considered a therapeutic target for patients with invasive mucinous adenocarcinoma of the lung (IMA). PMID:27626312
  21. we show that ErbB3 interacts with the ESCRT-0 subunit Hrs both in the presence and absence of heregulin. This indicates an ESCRT-mediated sorting of ErbB3 to late endosomes and lysosomes, and in line with this we show that impaired ESCRT function leads to an endosomal accumulation of ErbB3. PMID:28867611
  22. NRG1 genotype is associated with substance use. PMID:27353026
  23. Significant genetic risk for Hirschsprung disease (HSCR) was imparted by rs2435357 and rs2506030 at RET and by rs12707682 at SEMA3 in a Chinese population. No evidence was found of a genetic association between HSCR and either of the NRG1 SNPs rs7835688 and rs16879552, at either allele or genotype level. PMID:27203398
  24. High HRG1 expression is associated with breast cancer. PMID:26885614
  25. Results showed that heregulin-1ss mRNA was downregulated in 82 % of patients with hepatocellular carcinoma. PMID:27514687
  26. NRG1/ErbB2/Src/PTK2 signaling pathway may be a novel regulator of keloid fibroblast migration. PMID:27882385
  27. The plasma soluble NRG1 level was significantly higher in mild and moderate Alzheimer's disease patients compared to controls. PMID:27133777
  28. Data indicate a role for AXL receptor tyrosine kinase (AXL) in regulating the nuclear translocation of epidermal growth factor receptor (EGFR) and suggest that AXL-mediated SRC family kinases (SFKs) and neuregulin-1 (NRG1) expression promote this process. PMID:28049763
  29. NRG1FISH detection should be considered in patients with IMA pan-negative for known driver oncogenes. These results might suggest that NRG1 fusion is more frequent in IMA from Asian patient. PMID:27770508
  30. Results suggest genetic variation at the 5' and 3' ends of NRG1 are associated with schizophrenia. [Meta-Analysis] PMID:28094814
  31. Nrg1 acts as an axonal signal that drives virtually all stages of Schwann cell development and myelination.Nrg1 plays important role in the peripheral nerve injury and nerve repair.[review] PMID:26970613
  32. We also demonstrate that the effects of RET and NRG1 are universal across European and Asian ancestries. In contrast, we detected a European-specific association of a low-frequency variant, rs80227144, in SEMA3. Conditional analyses on the lead SNPs revealed a secondary association signal, corresponding to an Asian-specific, low-frequency missense variant encoding RET p.Asp489Asn PMID:27702942
  33. primary aromatase inhibitor treatment modulates expression of HER-family members as well as EGFR1 and NRG1 in HER-2/neu non-amplified breast cancers in vivo PMID:27343990
  34. GGF2 may improve contractile performance in the failing rat heart and that infrequent exposure to GGF2 may improve LV function PMID:27993643
  35. these results suggest that changes in Nrg1 signaling may influence the pathological development of AD, and exogenous Nrg1 may serve as a potential candidate for the prevention and treatment of AD. PMID:27486021
  36. Orbitofrontal sulcogyral pattern formation in schizophrenia may be associated with NRG1 allele frequency, which is closely related to neurodevelopment. PMID:26909665
  37. This study found a significant association between genetic variation at NRG1 and the modulation of small-worldness properties of the functional cortical network during the performance of an odd-ball task in healthy subjects. PMID:26650688
  38. Neuregulin-1 has now been accepted to have therapeutic potential in cardiovascular disease. The preclinical and clinical researches of NRG1 have demonstrated its advantage effects in cardiac function with multi-target cardiovascular biology and pathophysiology, but its influence on cardiac electrophysiology is rarely involved, which is a very important aspect and should not be ignored. [review] PMID:26902151
  39. Results suggest that silibinin is a potential anti-cancer drug to inhibit proliferative and invasive characteristics of the epithelial ovarian cancer (EOC) cells that exhibit an autocrine heregulin (HRG)/HER3 protein (HRG/HER3) pathway. PMID:26482609
  40. This population-based case-control study was carried out to determine whether polymorphisms in DISC1 and NRG1 genes could be associated with schizophrenia in the Chinese population. PMID:27236031
  41. SZuggest the use of polymeric PLGA and PEG-PLGA microparticles as delivery systems for NRG1 in the treatment of myocardial infarction. PMID:26546270
  42. NRG1 was a shared common susceptibility gene for major mental disorders in Han Chinese population. PMID:26888291
  43. overexpression of phospho-ALK and alternative receptor tyrosine kinases such as phospho-EGFR, phospho-HER3, and phospho-IGFR-1R was observed in both resistant cell lines. Additionally, NRG1, a ligand for HER3, is upregulated and responsible for resistance by activating the EGFR family pathways through the NRG1-HER3-EGFR axis. PMID:26992917
  44. Study found significant association between NRG1 (rs35753505) gene polymorphism and the risk of temporal lobe epilepsy in a Chinese Han population PMID:26071373
  45. Study shows that Neuregulin did not perform successfully as a biomarker for acute myocardial infarction or acute coronary syndrome in the emergency department. PMID:27110055
  46. This study demonstrate dysregulation of the NRG1-ErbB4/3 axis in both human and mouse ALS and to provide support for NRG1 supplementation as a possible therapeutic option for motor neuron disease PMID:26891847
  47. Data show that isoform beta2 of the heregulin (HRGbeta2) localizes at telomeres with the telomere-associated proteins TRF2 and RAP1. PMID:26318724
  48. Data indicate telomere-binding protein RAP1 as an interacting partner of isoform beta2 of the heregulin (HRGbeta2). PMID:26327598
  49. findings newly identify a physiological function of the NRG1-ErbB2-ErbB3 axis in trophoblast survival during human placental development. PMID:26490994
  50. Neuregulin-activated ERBB4 induces the SREBP-2 cholesterol biosynthetic pathway and increases low-density lipoprotein uptake. PMID:26535009

Show More

Hide All

Subcellular Location
[Pro-neuregulin-1, membrane-bound isoform]: Cell membrane; Single-pass type I membrane protein. Note=Does not seem to be active.; [Neuregulin-1]: Secreted.; [Isoform 8]: Nucleus. Note=May be nuclear.; [Isoform 9]: Secreted. Note=Has a signal peptide.; [Isoform 10]: Membrane; Single-pass type I membrane protein. Note=May possess an internal uncleaved signal sequence.
Protein Families
Neuregulin family
Tissue Specificity
Type I isoforms are the predominant forms expressed in the endocardium. Isoform alpha is expressed in breast, ovary, testis, prostate, heart, skeletal muscle, lung, placenta liver, kidney, salivary gland, small intestine and brain, but not in uterus, stom
Database Links

HGNC: 7997

UNIGENE: Hs.453951

KEGG: hsa:3084

STRING: 9606.ENSP00000349275

OMIM: 142445

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products