Abbreviation
Recombinant Human CSF1 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 90% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
The ED50 as determined by the dose-dependent stimulation of the proliferation of THP-1 cells is 0.5913-1.205 ng/mL.
Research Area
Cardiovascular
Alternative Names
Macrophage colony-stimulating factor 1; CSF-1; M-CSF; MCSF; Lanimostim; Proteoglycan macrophage colony-stimulating factor; Processed macrophage colony-stimulating factor 1; Macrophage colony-stimulating factor 1 43 kDa subunit; CSF1
Species
Homo sapiens (Human)
Expression Region
33-190aa
Target Protein Sequence
EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCN
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
The ED50 as determined by the dose-dependent stimulation of the proliferation of THP-1 cells is 0.5913-1.205 ng/mL.
-
The purity of CSF1 was greater than 90% as determined by SEC-HPLC
Description
CSF1 (M-CSF) is a key regulator of monocyte/macrophage survival, proliferation, and differentiation, making precise control of its bioactivity essential for meaningful functional studies. This recombinant human CSF1 fragment (residues 33–190) demonstrates strong signaling potency, with an ED50 of 0.59–1.21 ng/mL in a THP-1 proliferation assay, providing a reliable basis for macrophage differentiation protocols, dose-response proliferation assays, and downstream JAK/STAT or MAPK signaling pathway analyses. Endotoxin levels below 1.0 EU/μg minimize LPS-driven artifacts that can confound monocyte and macrophage activation readouts, which satisfies the purity and endotoxin criteria typical for in vivo inflammation models and sensitive cell-based functional studies. Expressed in yeast with a C-terminal 6×His tag and purified to greater than 95% by SDS-PAGE, this protein is also appropriate for use as a reference standard in M-CSF detection assays or as a coating antigen for antibody validation by ELISA.