Abbreviation
Recombinant Human CSF1 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①The ED50 as determined by the dose-dependent stimulation of the proliferation of THP-1 cells is 2.880-4.115 ng/mL.
②Measured by its binding ability in a functional ELISA. Immobilized Human CSF1 protein at 2 μg/mL can bind Anti-CSF1 recombinant antibody (CSB-RA006043MA1HU). The EC50 is 4.291-4.988 ng/mL.
③Measured by its binding ability in a functional ELISA. Immobilized Human CSF1 protein at 2 μg/mL can bind Human CSF1R protein (CSB-MP006044HU). The EC50 is 37.37-43.34 ng/mL.
Alternative Names
Macrophage colony-stimulating factor 1; CSF-1; M-CSF; MCSF; Lanimostim; Proteoglycan macrophage colony-stimulating factor; Processed macrophage colony-stimulating factor 1; Macrophage colony-stimulating factor 1 43 kDa subunit; CSF1
Species
Homo sapiens (Human)
Expression Region
33-190aa
Target Protein Sequence
EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCN
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
The ED50 as determined by the dose-dependent stimulation of the proliferation of THP-1 cells is 2.880-4.115 ng/mL.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CSF1 protein at 2 μg/ml can bind Anti-CSF1 recombinant antibody (CSB-RA006043MA1HU). The EC50 is 4.291-4.988 ng/mL.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CSF1 protein at 2 μg/ml can bind Human CSF1R protein (CSB-MP006044HU). The EC50 is 37.37-43.34 ng/mL.
-
CSF1 Recombinant Monoclonal Antibody (CSB-RA006043MA1HU) captured on Protein A Chip can bind Recombinant Human CSF1 protein with an affinity constant of 0.13 nM as detected by MetaSPR Assay (WeSPRTM 200).
Description
Macrophage colony-stimulating factor 1 governs the survival, proliferation, and differentiation of mononuclear phagocytes, making it a central regulator in both homeostatic tissue macrophage maintenance and pathological inflammation. This recombinant human CSF1, spanning residues 33–190 and expressed in mammalian cells to preserve native glycosylation, demonstrates potent bioactivity with an ED50 of 2.880–4.115 ng/mL in THP-1 cell proliferation assays, directly supporting dose-response studies of monocyte expansion, macrophage polarization experiments, and JAK/STAT or PI3K/AKT signaling pathway investigations. The endotoxin level below 1.0 EU/μg meets the stringent thresholds required for primary human monocyte cultures and bone marrow-derived macrophage differentiation protocols, where LPS contamination would confound cytokine-specific responses. Purity exceeding 95% by SDS-PAGE, combined with the validated proliferative activity, provides a reliable basis for use as a positive control in CSF1R binding assays, as an immunogen for antibody generation, and as a reference standard in cytokine quantification platforms.
