Abbreviation
Recombinant Human CSF1 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 0.01 EU/µg as determined by LAL method.
Activity
The ED50 as determined in a cell proliferation assay using M‑NFS‑60 mouse myelogenous leukemia lymphoblast cells is less than 4.16 ng/ml.
Alternative Names
Colony stimulating factor 1 (macrophage); Colony stimulating factor 1; Colony stimulating factor macrophage specific; CSF 1; CSF-1; CSF1; CSF1_HUMAN; Csfm; Lanimostim; M CSF; M-CSF; Macrophage Colony Stimulating Factor 1; Macrophage colony stimulating factor; MCSF; MGC31930; Processed macrophage colony-stimulating factor 1
Species
Homo sapiens (Human)
Expression Region
33-255aa
Target Protein Sequence
EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPR
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Datasheet & COA
Please contact us to get it.
Description
CSF1 drives macrophage survival, proliferation, and differentiation, making it a critical tool for dissecting myeloid biology and CSF1R-mediated signaling through the MAPK and JAK/STAT pathways. This recombinant human CSF1 (residues 33–255), expressed in mammalian cells with a C-terminal 6xHis tag, demonstrates strong signaling potency with an ED50 below 4.16 ng/mL in M-NFS-60 proliferation assays, confirming its suitability for functional studies including macrophage differentiation from monocytes, monocyte activation assays, and in vivo tumor-associated macrophage models. Endotoxin levels below 1.0 EU/μg eliminate LPS-driven artifacts that confound innate immune cell readouts, while purity exceeding 95% by SDS-PAGE supports use as a reference standard in M-CSF detection assays or as a coating antigen for antibody validation by ELISA. The mammalian expression system preserves native glycosylation patterns essential for proper receptor engagement and physiologically relevant downstream signaling.