Abbreviation
Recombinant Human FCGR3A protein (F176V), partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Loaded Anti-Human CD16a Antibody (CSB-RA008543MA1HU) on 96-Flat plate, can bind Human CD16a(F176V), with an affinity constant of 12 nM as determined in BLI assay (Gator Prime).
Species
Homo sapiens (Human)
Expression Region
17-208aa(F176V)
Target Protein Sequence
GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQ
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-HSA-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Loaded Anti-Human CD16a Antibody (CSB-RA008543MA1HU) on 96-Flat plate, can bind Human CD16a(F176V), with an affinity constant of 12 nM as determined in BLI assay (Gator Prime).
Description
CD16A mediates antibody-dependent cellular cytotoxicity and serves as a critical determinant of therapeutic antibody efficacy, with the F176V polymorphism conferring higher affinity for IgG1 and enhanced NK cell activation compared to the F176 variant. This recombinant protein, spanning the extracellular domain (aa 17–208) and produced in mammalian cells to preserve native glycosylation patterns, demonstrates a binding affinity of 12 nM to an anti-CD16A antibody in biolayer interferometry assays, confirming proper conformational integrity of the ligand-binding interface. The validated interaction kinetics support its use in therapeutic antibody epitope mapping, competitive inhibition screening to identify blocking candidates, and affinity characterization by SPR or BLI for antibody-receptor interaction studies. With purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this protein meets the quality thresholds commonly required for quantitative binding assays and serves as a positive control in ADCC-related functional studies.
-SDS.jpg)
-AC1.jpg)
