Abbreviation
Recombinant Human FCGR3A protein(F176V), partial, Biotinylated (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Anti-FCGR3A antibody (CSB-RA008543MA2HU) at 2 μg/ml can bind Biotinylated Human FCGR3A. The EC50 is 7.814-12.17 ng/ml.
Alternative Names
Low affinity immunoglobulin gamma Fc region receptor III-A; IgG Fc receptor III-A; CD16-II; CD16a antigen; Fc-gamma RIII-alpha; Fc-gamma RIII; Fc-gamma RIIIa; FcRIII; FcRIIIa; FcgammaRIIIA; FcR-10; IgG Fc receptor III-2; CD antigen CD16a
Species
Homo sapiens (Human)
Expression Region
17-208aa(F176V)
Target Protein Sequence
GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQ
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-Avi-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Anti-FCGR3A antibody (CSB-RA008543MA2HU) at 2 μg/ml can bind Biotinylated Human FCGR3A. The EC50 is 7.814-12.17 ng/ml.
-
The purity of FCGR3A was greater than 95% as determined by SEC-HPLC
Description
The F176V polymorphism in FCGR3A confers higher affinity for IgG1 and IgG3 antibodies, making this variant essential for studies of antibody-dependent cellular cytotoxicity and therapeutic antibody efficacy in patient populations carrying this allele. Mammalian expression preserves the native glycosylation pattern critical for authentic Fc receptor interactions, while the extracellular domain spanning residues 17–208 captures the complete ligand-binding interface. Functional ELISA validation demonstrates dose-dependent binding to an anti-FCGR3A antibody with an EC50 of 7.8–12.2 ng/ml, confirming conformational integrity suitable for ligand-binding assays, therapeutic antibody epitope mapping, and competitive inhibition screening of biologics targeting the Fc-FcγRIIIa axis. The biotinylated C-terminus enables direct immobilization in SPR and BLI platforms for affinity characterization, while purity exceeding 95% and endotoxin below 1.0 EU/μg meet the quality thresholds commonly required for quantitative binding studies and antibody screening workflows.