Recombinant Human Interleukin-8 (CXCL8), partial

Code: CSB-EP011671HU1
Size:
10μg
10μg50μg100μg200μg500μg1mg(1mg*1 or 500ug*2)
US$162
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: N-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
CXCL8
Uniprot NO.
Research Area
Immunology
Alternative Names
C-X-C motif chemokine hemokine (C-X-C motif) ligand 8Emoctakin;Granulocyte chemotactic protein 1 ;GCP-1Monocyte-derived neutrophil chemotactic factor ;MDNCFMonocyte-derived neutrophil-activating peptide ;MONAPNeutrophil-activating protein 1 ;NAP-1;Protein 3-10CT-cell chemotactic factor
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
28-99aa
Target Protein Sequence
SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
12.4kDa
Protein Length
partial
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively.
Gene References into Functions
  1. VEGF and IL-8 play a prominent role in the pathogenesis of early forms of rosacea and the hemostasis system. PMID:29578433
  2. High levels of LIFR in colorectal cancer (CRC) facilitated proliferation and migration of endothelial cells, resulting in an increase in angiogenic activity. Moreover, IL-8 was found to play a role in the LIFR induced angiogenesis. IL-8 levels were correlated with LIFR levels in CRC tissues, whereas depletion of IL-8 led to a reduced angiogenic activity of LIFR in CRC cells. PMID:29751081
  3. PKC-delta isoform plays a crucial role in Tat-TLR4 signaling pathway to activate NF-kappaB and CXCL8 production. PMID:28539656
  4. CXCL8 was a target of miR-204, and miR-204 suppression could not increase cell viability, migration, invasion, and EMT procedure when CXCL8 was silenced. PMID:29402343
  5. Interleukin 8 - 845 T/C and + 781 C/T polymorphisms were analyzed. For + 781C/T locus, in the dominant genetic model, significant difference between TT vs. CC + CT genotypes that significantly had a protective role against periodontitis disease. Positive association between distribution of IL8 - 845 T/C alleles and risk of periodontitis disease. C allele of IL-8 - 845 increased the risk of periodontitis disease. PMID:30078118
  6. These results suggest a direct involvement of IL-8-CXCR1/2 axes in GBM progression by promoting both cell proliferation and invasion and indirectly by promoting neovascularization in the form of vascular mimicry. PMID:30086759
  7. These results show that AKIP1 is crucial in cervical cancer angiogenesis and growth by elevating the levels of the NF-kappaB-dependent chemokines CXCL1, CXCL2, and CXCL8. PMID:29520695
  8. The extramembranous domain of HofQ (emHofQ) was shown to interact with various cytokines, of which IL-8 exhibited the strongest interaction. PMID:30088437
  9. he protein expression levels of IL-8 were significantly decreased in SZ patients, but no significant difference in the mRNA levels of IL-8 was observed between SZ patients and NC subjects. PMID:28476335
  10. immune system process is indispensable in the progression of disease in colon, and identifies that IL-8 and MMP-9 play potential critical roles for the progression. PMID:30074183
  11. IL-8 production was significantly enhanced following treatment with both IL-17A and CSE, while treatment with either IL-17A or CSE alone caused only a slight increase in IL-8 production. PMID:29463070
  12. Work identified IL-8 as a positive regulator of homotypic CIC formation via enhancing intercellular adhesion. PMID:30021676
  13. V2O5 induction of CXCL8 and CXCL11 chemokines may lead to the appearance and perpetuation of an inflammatory reaction into the dermal tissue. Further studies are required to evaluate dermal integrity and manifestations in subjects occupationally exposed, or living in polluted areas. PMID:29901202
  14. Study findings point out that PAR2 could play an essential role in gastroesophageal reflux disease (GERD) pathogenesis - even repeated short-term exposure to weakly acidic conditions lead to the upregulation of PAR2 and subsequent activation of the intense IL-8 release in the esophageal mucosa and initiation of mucosal immune response in GERD. PMID:29672302
  15. Given that IL-8, MIP-1beta, and MCP-1 are chemokines that play important roles in recruitment of immunocompetent cells for immune defense and tumor cell clearance, the observed lower levels of these markers with increasing PM2.5 exposure may provide insight into the mechanism by which DEE promotes lung cancer. PMID:29023999
  16. These results suggested that stemness induction in SKOV3 cells by macrophages co-cultured with SKOV3-derived OCSLCs involved IL-8/STAT3 signaling. PMID:29656182
  17. IL-8-251T>A (rs4073) Polymorphism is associated with gastric Cancer. PMID:30275190
  18. expression level of CXCL8 had a positive relationship with recurrence probability in Acute myeloid leukemia. PMID:29596823
  19. These data were in close agreement with the reduced cell migration and colony formation. Results from the present study suggested that reparixin and SCH527123 may be promising therapeutic agents for the treatment of pancreatic cancer by inhibiting the IL8/CXCR1/2 signaling cascade. PMID:29749433
  20. A urinary IL-8 level of less than 61.25 pg/ml is more sensitive for prediction of complete remission in idiopathic membranous nephropathy patients. PMID:29415357
  21. berberine inhibited the expression of MCP-1 and IL-8 induced by LPS. PMID:28852897
  22. Regarding the IL-8 promoter T - 251A, the TA and AA genotypes were associated with significantly decreased risks of nasopharyngeal carcinoma (NPC) in a Taiwanese population compared with the wild-type TT genotype. The mRNA and protein expression levels for NPC tissues revealed no significant associations among the 20 NPC samples with different genotypes. PMID:30200105
  23. IL-8 +781 T/C polymorphism is associated with the severe Clostridium difficile infection PMID:29203364
  24. ShRNA mediated down-regulation of CXCL8 resulted in inhibition of cell proliferation, viability and invasion in vitro and a near complete growth reduction of tumor in vivo. PMID:29679563
  25. CSF IL-8 concentrations were significantly elevated in CNS tumor patients as compared to non-tumoral individuals. AUC for CSF IL-8 was higher than for its index (CSF IL-8/serum IL-8). PMID:29086194
  26. High IL8 expression is associated with melanoma. PMID:29286146
  27. Lipo-CPFX, but not CPFX, retained the anti-IL-8 releasing activity. PMID:29337216
  28. The results indicate significant contribution of IL8 on survival of hormonal dependent early-stage breast cancer patients and association with established parameters such as estrogen receptors/progesterone receptor and HER2. PMID:28569250
  29. the frequency of non-classical monocytes expressing CXCL8 was increased in systemic sclerosis patient and monocytes expressing CXCL8 PMID:29127442
  30. ntermediate Molecular Mass Hyaluronan and CD44 interactions enhanced normal PMN phagocytosis and IL-8 production PMID:28730511
  31. serum levels in active vitiligo significantly elevated compared to those in stable vitiligo patients PMID:29115683
  32. High IL8 expression is associated with pancreatic adenocarcinoma. PMID:29205349
  33. Compared with controls, the interleukin (IL)-8 A/A genotype was more common in acute pancreatitis (AP). PMID:29215544
  34. The presence of neither the first transmembrane helix of the receptor nor the lipid bilayer significantly affected the interactions of IL-8 with Binding Site-I of CXCR1. PMID:29143165
  35. CXCL8 is highly expressed in cervical cancer tissues and cell lines, and correlated with malignant status and prognosis in cervical cancer patients. PMID:28883082
  36. In conclusion, to our knowledge, this is the first study in the association of rs4073 and rs2227306 polymorphisms with childhood asthma risk in the Tunisian population. PMID:28993876
  37. Results show that IL8 expression level is regulated by APE1 which activates NF-KB. PMID:27388124
  38. aberrant miR-520c-3p expression may lead to reduced IL-8 expression and promote the mesenchymal phenotype in breast cancer cells, thereby increasing invasive growth. PMID:29048659
  39. increased levels of IL-8 are associated with factors of worse prognosis in ovarian cancer PMID:28872976
  40. Significantly elevated blood levels of IL-8 in myelodysplastic syndrome patients. PMID:28856536
  41. the elevated concentrations of CXCL13, CXCL8, and CXCL10 or their increasing CSF/serum ratios may be potential biomarkers of neurosyphilis PMID:27650493
  42. Results implicated the important role of PRL-3 in glycolysis metabolism through improving IL-8 secretion in colorectal cancer cells, and PRL-3 mediated glycolysis contributed to the promotion of cancer metastasis. PMID:28791350
  43. Changes in serum IL-8 levels could be used to monitor and predict clinical benefit from immune checkpoint blockade in melanoma and NSCLC patients PMID:28595336
  44. Lung cancer patients showed significantly lower levels of serum VEGF (1.9 fold) and IL-8 (~9 fold) than COPD patients. VEGF level was significantly higher (2.6 fold) in metastatic than non-metastatic cancer patients. An increase in MMP-9 (~1.6 fold) levels was observed in lung cancer patients. PMID:27811960
  45. CXCL1/8 secreted by adipose-derived mesenchymal stem cells could promote breast cancer angiogenesis. PMID:28514506
  46. our meta-analysis suggests that the IL-8 rs4073, A2767T, T11722T2, rs2234671, rs2230054, rs1126579, rs2227306, rs2227307, rs2227532, and T-738A polymorphisms are not associated with periodontitis while the IL-8 C1633T and rs1126580 polymorphisms may elevate the susceptibility of periodontitis based on the currently available evidences. PMID:28446725
  47. An analogue of human CXCL8, CXCL8(3-72)K11R/G31P (hG31P) has been developed. PMID:28754019
  48. inflammation triggered property of Microcystin-LR via IL-8/CXCR2 signaling PMID:29197248
  49. A high IL-8 content in urine sampled on day 1 after renal transplantation was positively correlated with the activity of metalloproteinase-9 in urine. This proves that both of these chemokines cooperate in ischaemia-reperfusion injuries in transplanted kidneys. PMID:28494217
  50. We discovered that IL-8 secreted from decidual stromal cells is a key cytokine enhancing the invasiveness of trophoblasts PMID:28328096

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Intercrine alpha (chemokine CxC) family
Database Links

HGNC: 6025

UNIGENE: Hs.624

KEGG: hsa:3576

STRING: 9606.ENSP00000306512

OMIM: 146930

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products