Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined by its ability to activate chimeric receptor and induce reporter gene expression in HEK293 cell line used Splite TEV activity detection platform is less than 15 ng/mL.
Alternative Names
(Ala-IL-8)77; (Ser-IL-8)72; 9E3; Beta thromboglobulin like protein; C-X-C motif chemokine 8; CEF-4; chemokine; CXC motif; ligand 8; CXCL8; Emoctakin; GCP-1; GCP/IL-8 protein I; GCP/IL-8 protein II; GCP/IL-8 protein III; GCP/IL-8 protein IV; GCP/IL-8 protein V; GCP/IL-8 protein VI; GCP1; Granulocyte chemotactic protein 1; IL-8; IL-8(1-77); IL-8(9-77); IL8; IL8/NAP1 form I; IL8/NAP1 form II; IL8/NAP1 form III; IL8/NAP1 form IV; IL8/NAP1 form V; IL8/NAP1 form VI; IL8_HUMAN; Inteleukin 8; LECT; LUCT; Lymphocyte-derived neutrophil-activating factor; LYNAP; MDNCF; MDNCF-b; MDNCF-c; MONAP; Monocyte derived neutrophil activating peptide; Monocyte derived neutrophil chemotactic factor; Monocyte-derived neutrophil chemotactic factor; Monocyte-derived neutrophil-activating peptide; NAF; NAP 1; NAP-1; NAP1; Neutrophil activating peptide 1; Neutrophil activating protein 1; Neutrophil-activating factor; Neutrophil-activating protein 1; Protein 3 10C; Protein 3-10C; SCYB 8; SCYB8; Small inducible cytokine subfamily B member 8; T cell chemotactic factor ; T-cell chemotactic factor; TSG 1; TSG1
Species
Homo sapiens (Human)
Expression Region
23-99aa
Target Protein Sequence
AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Datasheet & COA
Please contact us to get it.