Abbreviation
Recombinant Human CXCL8 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CXCL8 at 2 μg/mL can bind Anti-CXCL8 recombinant antibody (CSB-RA011671MA1HU). The EC50 is 43.95-46.76 ng/mL.
Alternative Names
Interleukin-8; IL-8; C-X-C motif chemokine 8; Chemokine (C-X-C motif) ligand 8; Emoctakin; Granulocyte chemotactic protein 1 (GCP-1); Monocyte-derived neutrophil chemotactic factor (MDNCF); CXCL8; IL8
Species
Homo sapiens (Human)
Expression Region
28-99aa
Target Protein Sequence
SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CXCL8 at 2 μg/ml can bind Anti-CXCL8 recombinant antibody (CSB-RA011671MA1HU). The EC50 is 43.95-46.76 ng/mL.
Description
CXCL8 orchestrates neutrophil recruitment and activation at sites of inflammation, making precise control of its signaling potency essential for dissecting immune cell behavior in vitro. This recombinant protein, spanning residues 28–99 of the mature human sequence, demonstrates specific antibody binding in functional ELISA with an EC50 of 43.95–46.76 ng/mL, providing quantitative evidence of correct folding and epitope accessibility that supports its use as a coating antigen in antibody validation assays, an immunogen for monoclonal antibody development, and a positive control in cytokine detection platforms. The endotoxin level below 1.0 EU/μg meets the threshold required for neutrophil chemotaxis assays and primary immune cell activation studies, where LPS contamination would confound interpretation of CXCL8-specific signaling through CXCR1 and CXCR2. Purity exceeding 95% by SDS-PAGE, combined with the validated binding activity, aligns with standards expected in signaling pathway studies examining NF-κB and MAPK activation downstream of chemokine receptor engagement.
