Home
Product
Protein
Recombinant Proteins
Recombinant Human Interleukin-36 beta (IL36B), partial

Recombinant Human Interleukin-36 beta (IL36B), partial

Code
MSDS	MSDS Datasheet
Size	Pls inquire
Source
Conjugate
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Abbreviation

IL36B

Purity

>85% (SDS-PAGE)

Target Names

IL36B

Uniprot NO.

Q9NZH7

Alternative Names

2310043N20Rik; Family of interleukin 1 eta; FIL1 (ETA); FIL1; FIL1 eta; FIL1H; FILI-(ETA); IL 1F8 (FIL1 eta; IL 1F8; IL 1H2; IL-1 eta; IL-1F8; IL-1H2; IL1 ETA; IL1F8 (Canonical product IL 1F8a); IL1F8; IL1F8_HUMAN; IL1H2; IL36 beta; IL36B; Interleukin 1 family, member 8 (eta); Interleukin 1 family, member 8; Interleukin 1 homolog 2; Interleukin 1 Superfamily e; Interleukin 36 beta; Interleukin-1 eta; Interleukin-1 family member 8; Interleukin-1 homolog 2; MGC126880; MGC126882; OTTMUSP00000012797; RP23-176J12.1

Species

Homo sapiens (Human)

Source

Yeast

Expression Region

5-157aa

Target Protein Sequence

REAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKLQGSQDNIGKDTCWKLVGIHTCINLDVRESCFMGTLDQWGIGVGRKKWKSSFQHHHLRKKDKDFSSMRTN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Partial

Tag Info

N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8

Storage Condition

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Cytokine that binds to and signals through the IL1RL2/IL-36R receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells linked to a pro-inflammatory response. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP. Stimulates production of interleukin-6 and interleukin-8 in synovial fibrobasts, articular chondrocytes and mature adipocytes. Induces expression of a number of antimicrobial peptides including beta-defensins 4 and 103 as well as a number of matrix metalloproteases. Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T-cells to drive tissue infiltration, cell maturation and cell proliferation. In cultured keratinocytes induces the expression of macrophage, T-cell, and neutrophil chemokines, such as CCL3, CCL4, CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20 and CXCL1, and the production of proinflammatory cytokines such as TNF-alpha, IL-8 and IL-6.

Gene References into Functions

IL-36-mediated IL-6 and CXCL8 production in human lung fibroblasts and bronchial epithelial cells may be involved in pulmonary inflammation especially caused by bacterial or viral infections. PMID:28869889
With a focus on the skin as a target for microbial and viral invasion, the current knowledge of IL-36: IL-36alpha, IL-36beta and IL-36gamma, functions is reviewed. One physiological function of the IL-36smay be to counteract microbial immune evasion. [Review] PMID:28811383
IL36B expression is induced in keratinocytes by Toll-like receptor ligands suggesting a function in barrier immune defense. PMID:22318382
IL-1F8 functions as an inducer of antimicrobial peptide and matrix metalloproteinase expression by keratinocytes; IL-1F8 is overexpressed in transgenic psoriatic model mouse skin. PMID:21242515
IL-1F6 and IL-1F8, in addition to IL-1F9, activate the pathway leading to NF-kappaB in an IL-1Rrp2-dependent manner in Jurkat cells PMID:14734551
Joint and serum IL-1F8 protein levels did not correlate with inflammation, but they were high in samples from patients with rheumatoid arthritis PMID:16646978

Hide All

Subcellular Location

Cytoplasm. Secreted.

Protein Families

IL-1 family

Tissue Specificity

Expression at low levels in tonsil, bone marrow, heart, placenta, lung, testis and colon but not in any hematopoietic cell lines. Not detected in adipose tissue. Expressed at higher levels in psoriatic plaques than in symptomless psoriatic skin or healthy

Database Links

HGNC: 15564

UNIGENE: Hs.278909

KEGG: hsa:27177

STRING: 9606.ENSP00000259213

OMIM: 605508

Promotions