Home
Product
Protein
Recombinant Proteins
Recombinant Human Guanylate cyclase activator 2B (GUCA2B)

Recombinant Human Guanylate cyclase activator 2B (GUCA2B)

Code
MSDS	MSDS Datasheet
Size	Pls inquire
Source
Conjugate
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Abbreviation

GUCA2B

Purity

>85% (SDS-PAGE)

Target Names

GUCA2B

Uniprot NO.

Q16661

Research Area

Signal Transduction

Alternative Names

GUCA2B; GCAP II; GCAP-II; Guanylate cyclase activator 2B (uroguanylin); Guanylate cyclase activator 2B; Guanylate cyclase C-activating peptide II; GUC2B_HUMAN; GUCA2B; UGN; Uroguanylin

Species

Homo sapiens (Human)

Source

Baculovirus

Expression Region

27-112aa

Target Protein Sequence

VYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

11.5kD

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport.

Gene References into Functions

The simulations suggested that all missense SNPs considered as convergent deleterious caused some kind of structural change to the uroguanylin peptide. Additionally, four of these SNPs were also shown to cause modifications in peptide flexibility, possibly resulting in functional changes. PMID:27620667
Uroguanylin concentrations are increased in patients with chronic renal failure, nephrotic syndrome, or those on dialysis. PMID:15780094
The occurrences of the C-A haplotype (rs883062-rs1047047) and the C-A-G haplotype (rs883062-rs1047047-rs2297566) were significantly higher in the essential hypertension group than in the controls. PMID:18037771

Hide All

Subcellular Location

Secreted.

Protein Families

Guanylin family

Tissue Specificity

Stomach and intestine.

Database Links

HGNC: 4683

UNIGENE: Hs.32966

KEGG: hsa:2981

STRING: 9606.ENSP00000361662