Recombinant Human Gastric inhibitory polypeptide receptor (GIPR), partial

CSB-BP009438HU1
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$528
Quantity:
Express system: Baculovirus
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
GIPR
Uniprot NO.
Research Area
Others
Species
Homo sapiens (Human)
Source
Baculovirus
Expression Region
22-138aa
Target Protein Sequence
RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ
Mol. Weight
17.3
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Buffer
Tris-based buffer,50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description

The gene encoding the Human GIPR protein (22-138aa) is inserted into a plasmid vector to form the recombinant plasmid, which is introduced into baculovirus cells. baculovirus cells that have successfully taken up the recombinant plasmid can be selected based on their ability to survive in the presence of a specific antibiotic. The recombinant plasmid-containing baculovirus cells are cultured under conditions that promote the expression of the interested gene. The protein is fused with a N-terminal 10xHis tag and C-terminal Myc tag. After expression, the recombinant Human GIPR protein is isolated and purified from the cell lysate through affinity purification. The resulting recombinant Human GIPR protein is resolved by denaturing SDS-PAGE, allowing its purity to be estimated, greater than 85%.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function
This is a receptor for GIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Gene References into Functions
  1. an association between the GIPR rs2302382 polymorphism and type 2 diabetes mellitus in Egyptian patients. PMID:28744963
  2. Data suggest that GIPR (gastric inhibitory polypeptide receptor) is among the few GPCRs (G-protein-coupled receptors) which signal through G-proteins (GTP-binding protein Gs alpha subunit, here) both at plasma membrane and in endosomes; recombinant proteins expressed in HEK293 cells were used in these studies. PMID:27641811
  3. GIPR overexpression does not appear to affect acromegalic patients' clinical features PMID:28179449
  4. Study shows the internalization of GIPR involving clathrin-coated pits, AP-2 and dynamin and its subsequent intracellular trafficking. GIP stimulates a rapid robust internalization of the GIPR, the major part being directed to lysosomes. PMID:26225752
  5. The common variant rs10423928 in the GIPR gene is associated with increased risk of stroke in patients with type 2 diabetes. PMID:26395740
  6. Body mass index change for the A/T+A/A in GIPR genotypes was significantly higher than that for the T/T genotype. rs10423928 may predict weight gain in schizophrenia. PMID:25321336
  7. The potential future role of gastric inhibitory peptide (GIP) receptors as molecular targets in neuroendocrine neoplasms may be dependent on the tumor grade. PMID:25591947
  8. Results show that GIPR undergoes trafficking between the plasma membrane and intracellular compartments of both GIP-stimulated and unstimulated adipocytes. PMID:25047836
  9. GIPR is overexpressed in gastric and duodenal neuroendocrine tumors PMID:24565507
  10. GIPR expression was downregulated in subcutaneous adipose tissue from obese patients and correlated negatively with body mass index, waist circumference, systolic blood pressure, and glucose and triglyceride levels. PMID:24512489
  11. GIPR promoter was hypomethylated in type 2 diabetic patients as compared to controls. PMID:24086540
  12. This study demonstrates an association between a functional GIPR polymorphism Glu354Gln (rs1800437) and Bone mineral density and fracture risk. PMID:24446656
  13. Compared with the current treatment standard SSTR2, GIPR has only somewhat lesser absolute gene expression in tumor tissue but much lesser expression in normal tissue, making it a promising new target for neuroendocrine tumor imaging and therapy. PMID:24238043
  14. Structural and pharmacological characterization of novel potent and selective monoclonal antibody antagonists of glucose-dependent insulinotropic polypeptide receptor. PMID:23689510
  15. Functional expression of a GIP receptor mutant lacking N-glycosylation is rescued by co-expressed wild type GLP1 receptor, which suggests formation of a GIP-GLP1 receptor heteromer. PMID:22412906
  16. Our prospective, observational study indicates that the type 2 diabetes risk by dietary intake of carbohydrate and fat may be dependent on GIPR genotype. PMID:22399504
  17. Most of the somatostatin receptor-negative neuroendocrine tumors and GLP-1 receptor-negative malignant insulinomas are GIP receptor positive. PMID:22112810
  18. The T allele of GIPR rs2287019 is associated with greater improvement of glucose homeostasis in individuals who choose a low-fat, high-carbohydrate, and high-fiber diet. PMID:22237064
  19. a role of the adipocyte GIPr in nutrient-dependent regulation of body weight and lean mass, but it does not support a direct and independent role for the adipocyte or beta-cell GIPr in promoting adipogenesis. PMID:22027838
  20. Variations of the GIPR sequence are not associated with childhood obesity. PMID:20516203
  21. Variants at the GIPR locus associated with 2-h glucose level (rs10423928, beta (s.e.m.) = 0.09 (0.01) mmol/l per A allele, P = 2.0 x 10(-15)), were identified. PMID:20081857
  22. Proximal 5' flanking region is TATA-less and contains a GC-rich region involved in cellular expression. PMID:12530665
  23. differences in cellular response to gastric inhibitory polypeptide(GIP) mediated by endothelin-1 may be related to differences in activation of GIP receptor splice variants PMID:12721154
  24. Glucose-stimulated insulin secretion is maintained despite complete absence of both GIP-1 and GIP receptors. Role for incretin receptors as essential downstream targets for glucoregulatory actions of DPP-IV inhibitors. PMID:15111503
  25. Proximal promoter of GIP-R gene contains a GC-rich region capable of binding to Sp1 and SP3. PMID:15666829
  26. the promoter region of the GIP-R gene revealed six consensus sequences important in regulating the reporter gene activity and capable of binding to Sp1 and Sp3 transcription factors PMID:16087722
  27. GIPR adipose tissue gene expression was significantly lower in insulin resistant obese non-diabetic women PMID:17395281
  28. GIPR overexpression was observed in pediatric and adult adrenocortical tumors PMID:18971217
  29. Diabetic kidney lesions of GIPRdn transgenic mice: podocyte hypertrophy and thickening of the GBM precede glomerular hypertrophy and glomerulosclerosis. PMID:19211686
  30. Our data suggest a potential relevance of GIPR variants for obesity. PMID:19254363
  31. Decreased TCF7L2 protein levels in type 2 diabetes mellitus correlate with downregulation of GLP-1R and GIP-R. PMID:19386626

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 2 family
Database Links

HGNC: 4271

UNIGENE: Hs.251412

KEGG: hsa:2696

STRING: 9606.ENSP00000467494

OMIM: 137241

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products