Abbreviation
Recombinant Human GIPR protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human GIPR at 2 μg/mL can bind Anti-GIPR recombinant antibody (CSB-RA009438MA1HU). The EC50 is 16.18-18.70 ng/mL.
Species
Homo sapiens (Human)
Expression Region
22-138aa
Target Protein Sequence
RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human GIPR at 2μg/mL can bind Anti-GIPR recombinant antibody (CSB-RA009438MA1HU)，the EC50 is 16.18-18.70 ng/mL.
-
The purity of GIPR was greater than 95% as determined by SEC-HPLC
Description
GIPR, a class B G protein-coupled receptor, mediates glucose-dependent insulinotropic polypeptide signaling and represents a therapeutic target in metabolic disease research. This mammalian-expressed fragment spanning residues 22–138 captures the extracellular ligand-binding domain, where native glycosylation and disulfide bonding are critical for antibody recognition and ligand interaction studies. Functional ELISA validation demonstrates specific binding to an anti-GIPR recombinant antibody with an EC50 of 16.18–18.70 ng/mL, confirming that the protein retains conformational epitopes required for therapeutic antibody screening, competitive inhibition assays, and epitope mapping experiments. With purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this fragment provides a suitable basis for surface plasmon resonance affinity characterization, biolayer interferometry kinetic studies, and blocking antibody validation in drug discovery workflows targeting incretin receptor pathways.
