Abbreviation
Recombinant Human DLL3 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human DLL3 at 2 μg/mL can bind Anti-DLL3 recombinant antibody (CSB-RA882142MA2HU). The EC50 is 1.107-1.282 ng/mL.
Research Area
Developmental Biology
Alternative Names
Delta-like protein 3; Drosophila Delta homolog 3 (Delta3)
Species
Homo sapiens (Human)
Expression Region
391-492aa
Target Protein Sequence
DLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human DLL3 at 2 μg/ml can bind Anti-DLL3 recombinant antibody (CSB-RA882142MA2HU). The EC50 is 1.107-1.282 ng/mL.
-
The purity of DLL3 was greater than 95% as determined by SEC-HPLC
Description
Delta-like protein 3 functions as a non-canonical Notch ligand that inhibits rather than activates Notch signaling, making it a critical regulator of somitogenesis and a therapeutic target in neuroendocrine cancers. This mammalian-expressed construct spanning residues 391–492 captures a functionally validated extracellular domain fragment, as demonstrated by its binding to an anti-DLL3 recombinant antibody with an EC50 of 1.107–1.282 ng/mL in functional ELISA, confirming conformational integrity suitable for antibody epitope mapping, therapeutic antibody validation, and competitive inhibition screening. The mammalian expression system supports native post-translational modifications and proper disulfide bond formation, features that align with standards expected in surface plasmon resonance and biolayer interferometry assays for affinity characterization of DLL3-targeting biologics. With purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this protein meets the quality thresholds commonly required for drug discovery campaigns focused on antibody-drug conjugates and small-molecule inhibitor development in oncology research.
