Abbreviation
Recombinant Human DLL3 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human DLL3 at 1 μg/mL can bind Anti-DLL3 recombinant antibody (CSB-RA882142MA2HU). The EC50 is 6.211-7.209 ng/mL.
Research Area
Developmental Biology
Alternative Names
Delta-like protein 3; Drosophila Delta homolog 3 (Delta3)
Species
Homo sapiens (Human)
Expression Region
429-492aa
Target Protein Sequence
RADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal mFc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human DLL3 at 1 μg/ml can bind Anti-DLL3 recombinant antibody (CSB-RA882142MA2HU). The EC50 is 6.211-7.209 ng/mL.
Description
Delta-like protein 3 serves as a non-canonical Notch ligand critical in somitogenesis and neuroendocrine tumor biology, yet its extracellular domain remains challenging to produce in conformationally authentic form. This mammalian-expressed fragment spanning residues 429–492 demonstrates quantifiable binding to an anti-DLL3 recombinant antibody with an EC50 of 6.211–7.209 ng/mL in functional ELISA, confirming that the protein adopts a native-like conformation suitable for therapeutic antibody epitope mapping and blocking antibody screening campaigns. The C-terminal mFc tag enables straightforward immobilization in surface plasmon resonance and biolayer interferometry platforms for affinity characterization of DLL3-targeting biologics, a critical step in validating candidates for small cell lung cancer and other neuroendocrine malignancies. Purity exceeding 95% by SDS-PAGE and endotoxin below 1.0 EU/μg align with standards expected in competitive inhibition assays and as positive controls in ligand-binding studies.