Home
Product
Protein
Recombinant Proteins
Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 8 (CEACAM8)

Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 8 (CEACAM8)

CSB-EP005168HU

Rate （N/A）
Review （0）

Size:

20ug100ug1mg(1mg*1 or 500ug*2)

US$224

Quantity:

Express system: E.coli

Species: Homo sapiens (Human)

Tag Info: N-terminal 6xHis-SUMO-tagged

Send an Inquiry

Start an on-line Chat

Orders can only be placed from within the U.S.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

CEACAM8

Uniprot NO.

P31997

Research Area

Immunology

Alternative Names

CD67 antigen Carcinoembryonic antigen CGM6 Non-specific cross-reacting antigen NCA-95 CD_antigen: CD66b

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

35-320aa

Target Protein Sequence

QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD

Mol. Weight

47.5kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-SUMO-tagged

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Description

The Recombinant Human CEACAM8 protein is an exceptional resource for research in immunology, focusing on the Carcinoembryonic antigen-related cell adhesion molecule 8 (CEACAM8). Known also as CD67 antigen, Carcinoembryonic antigen CGM6, Non-specific cross-reacting antigen NCA-95, and CD66b, this protein plays a crucial role in cellular adhesion, immune cell activation, and signaling pathways. Produced in E. coli, the product covers the full length of the mature CEACAM8 protein (35-320aa) and features an N-terminal 6xHis-SUMO tag for efficient purification and detection purposes.

With a purity greater than 90% as determined by SDS-PAGE, our Recombinant Human CEACAM8 protein is supplied as a lyophilized powder to ensure consistency and dependability in your immunology research. This product facilitates accurate and reliable results in a variety of research areas, such as inflammation, immune response, and cancer biology.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

■ Q&A

You wouldn't happen to have lots that were lyophilized from PBS or any other non-amine buffer would you? The Tris in the buffer makes it difficult to do amine-based labeling like biotinylation without further clean-up.

We will try to dialysis and exchange the stock protein into PBS buffer first, lead time is 3-7 business days if we succeed. Otherwise, we will prepare a new lot with PBS buffer, lead time is 13-23 business days.

Target Background

Function

Cell surface glycoprotein that plays a role in cell adhesion in a calcium-independent manner. Mediates heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules, such as CEACAM6. Heterophilic interaction with CEACAM8 occurs in activated neutrophils.

Gene References into Functions

Increased CD66b positive tumor-infiltrating neutrophils (CD66b + TINs) was significantly associated with presence of metastasis, S stage, and nonseminomatous germ cell tumor diagnosis. PMID:27863478
Data suggest ways in which carcinoembryonic antigen-related cell adhesion molecules CEACAM6 and CEACAM8 regulate the biological functions of one another. PMID:26483485
Granulocytes from type 2 diabetes patients display higher granulocyte cell surface expression of CD66b compared with values of healthy controls. PMID:23686079
The highly elevated gene expression of CEACAM6 and CEACAM8 in primary myelofibrosis can serve as molecular markers of myelofibrotic transformation. PMID:21470677
All the leukemic samples showed overexpression of CEACAM6 and 8 when compared with normal granulocytes. PMID:17909799
CD66b molecules are involved in regulating adhesion and activation of eosinophils, possibly through their localization in lipid rafts and interaction with other cell surface molecules, such as CD11b. PMID:18056392