Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 8(CEACAM8) (Active)

CSB-MP005168HU
Size:
20ug
20ug100ug1mg
US$116
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: C-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM8 at 2 μg/mL can bind Anti-CEACAM8 recombinant antibody (CSB-RA005168MA1HU). The EC50 is 19.38-21.68 ng/mL.
Target Names
CEACAM8
Uniprot NO.
Alternative Names
CGM6
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
35-320aa
Target Protein Sequence
QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD
Mol. Weight
34.3 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-tagged
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM8 at 2μg/mL can bind Anti-CEACAM8 recombinant antibody (CSB-RA005168MA1HU),the EC50 is 19.38-21.68 ng/mL.
Description

The process for generating the recombinant human CEACAM8 protein includes cloning the target gene, constructing the plasmid, expressing the protein, and purifying the protein. The expression region responding to the 35-320aa of the human CEACAM8. The protein is fused with a C-terminal 10xHis-tag. Its expression system is a mammalian cell line. The final product is purified through Ni-NTA affinity chromatography. Its purity surpasses 95% as assessed by SDS-PAGE, and endotoxin levels are less than 1.0 EU/μg as determined by LAL assays. ELISA confirms its binding activity with the CEACAM8 recombinant antibody (CSB-RA005168MA1HU), with an EC50 of 19.38-21.68 ng/mL.

Human CEACAM8, also known as CD66b, is a glycosylphosphatidylinositol (GPI)-anchored membrane glycoprotein that plays a crucial role in the immune response, particularly in neutrophil activation and inflammation [7]. CEACAM8 is predominantly expressed on human neutrophils and is stored in specific granules, where it serves as a marker for neutrophil activation and degranulation [5][6]. Upon stimulation, CEACAM8 is rapidly mobilized to the cell surface, facilitating various immune functions, including adhesion and the production of reactive oxygen species [4].

In addition to cell adhesion, CEACAM8 also modulates immune responses. Soluble CEACAM8 can interact with CEACAM1, inhibiting TLR2-triggered immune responses, which suggests a regulatory function in inflammation [4]. This interaction highlights the importance of CEACAM8 in the communication between neutrophils and other immune cells, thereby influencing the overall immune landscape during inflammatory processes [3]. Furthermore, CEACAM8 has been implicated in various pathological conditions, including systemic lupus erythematosus (SLE), where it is released in response to extracellular chromatin, amplifying the inflammatory response [1]. Moreover, CEACAM8 has been associated with inflammation and immune cell infiltration in various cancers, serving as a potential biomarker for disease progression and response to therapy [2].

References:
[1] Cheng, Q., Chen, X., Xu, J., Chen, M., Zhang, P., Wu, H., … & Du, Y. (2022). Lncrna x‐inactive‐specific transcript is a potential biomarker related to changes in cd4+ t cell levels in systemic lupus erythematosus. Rheumatology & Autoimmunity, 2(3), 159-174. https://doi.org/10.1002/rai2.12048
[2] Guo, C., Zeng, F., Liu, H., Wang, J., Xue, H., & Luo, J. (2022). Establish immune-related gene prognostic index for esophageal cancer. Frontiers in Genetics, 13. https://doi.org/10.3389/fgene.2022.956915
[3] Ribon, M., Mussard, J., Semerano, L., Singer, B., & Decker, P. (2019). Extracellular chromatin triggers release of soluble ceacam8 upon activation of neutrophils. Frontiers in Immunology, 10. https://doi.org/10.3389/fimmu.2019.01346
[4] Singer, B., Opp, L., Heinrich, A., Schreiber, F., Binding-Liermann, R., Berrocal-Almanza, L., … & Slevogt, H. (2014). Soluble ceacam8 interacts with ceacam1 inhibiting tlr2-triggered immune responses. Plos One, 9(4), e94106. https://doi.org/10.1371/journal.pone.0094106
[5] Wu, H. and Han, F. (2023). Investigation of shared genes and regulatory mechanisms associated with coronavirus disease 2019 and ischemic stroke. Frontiers in Neurology, 14. https://doi.org/10.3389/fneur.2023.1151946
[6] Xiao, L., Xiao, W., & Lin, S. (2022). Potential biomarkers for active renal involvement in systemic lupus erythematosus patients. Frontiers in Medicine, 9. https://doi.org/10.3389/fmed.2022.995103
[7] Yang, L., Pan, X., Zhang, Y., Zhao, D., Wang, L., Yuan, G., … & Li, W. (2022). Bioinformatics analysis to screen for genes related to myocardial infarction. Frontiers in Genetics, 13. https://doi.org/10.3389/fgene.2022.990888

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function
Cell surface glycoprotein that plays a role in cell adhesion in a calcium-independent manner. Mediates heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules, such as CEACAM6. Heterophilic interaction with CEACAM8 occurs in activated neutrophils.
Gene References into Functions
  1. Increased CD66b positive tumor-infiltrating neutrophils (CD66b + TINs) was significantly associated with presence of metastasis, S stage, and nonseminomatous germ cell tumor diagnosis. PMID:27863478
  2. Data suggest ways in which carcinoembryonic antigen-related cell adhesion molecules CEACAM6 and CEACAM8 regulate the biological functions of one another. PMID:26483485
  3. Granulocytes from type 2 diabetes patients display higher granulocyte cell surface expression of CD66b compared with values of healthy controls. PMID:23686079
  4. The highly elevated gene expression of CEACAM6 and CEACAM8 in primary myelofibrosis can serve as molecular markers of myelofibrotic transformation. PMID:21470677
  5. All the leukemic samples showed overexpression of CEACAM6 and 8 when compared with normal granulocytes. PMID:17909799
  6. CD66b molecules are involved in regulating adhesion and activation of eosinophils, possibly through their localization in lipid rafts and interaction with other cell surface molecules, such as CD11b. PMID:18056392

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor. Cell surface.
Protein Families
Immunoglobulin superfamily, CEA family
Tissue Specificity
Expressed in leukocytes of chronic myeloid Leukemia patients and bone marrow.
Database Links

HGNC: 1820

UNIGENE: Hs.41

KEGG: hsa:1088

STRING: 9606.ENSP00000244336

OMIM: 615747

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products