Abbreviation
Recombinant Human CEACAM8 protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM8 at 2 μg/mL can bind Anti-CEACAM8 recombinant antibody (CSB-RA005168MA1HU). The EC50 is 19.38-21.68 ng/mL.
Species
Homo sapiens (Human)
Expression Region
35-320aa
Target Protein Sequence
QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM8 at 2μg/mL can bind Anti-CEACAM8 recombinant antibody (CSB-RA005168MA1HU)，the EC50 is 19.38-21.68 ng/mL.
Description
CEACAM8, a granulocyte-specific glycoprotein implicated in neutrophil activation and tumor-immune interactions, presents technical challenges for recombinant production due to its heavily glycosylated extracellular architecture. This mammalian-expressed construct spans the full mature protein (residues 35–320) and demonstrates quantifiable antibody binding in functional ELISA, with an EC50 of 19.38–21.68 ng/mL against an anti-CEACAM8 recombinant antibody, confirming that native epitopes are accessible for immunological studies. The measured activity supports use in antibody development and validation workflows, where epitope integrity is critical, as well as in cell adhesion assays and immune cell trafficking models that depend on CEACAM8-mediated interactions with selectins or heterophilic binding partners. Purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg align with standards expected in functional cell-based assays and in vitro binding experiments where contaminant interference must be minimized.
