Recombinant Human C-C motif chemokine 8 (CCL8)

Mammalian cell

Code
MSDS	MSDS Datasheet
Size	Pls inquire
Source
Conjugate
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

>85% (SDS-PAGE)

Target Names

CCL8

Uniprot NO.

P80075

Research Area

Immunology

Species

Homo sapiens (Human)

Source

Baculovirus

Expression Region

24-99aa

Target Protein Sequence

QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTQRGKEVCADPKERWVRDSMKHLDQIFQNLKP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

10.9kD

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Chemotactic factor that attracts monocytes, lymphocytes, basophils and eosinophils. May play a role in neoplasia and inflammatory host responses. This protein can bind heparin. The processed form MCP-2(6-76) does not show monocyte chemotactic activity, but inhibits the chemotactic effect most predominantly of CCL7, and also of CCL2 and CCL5 and CCL8.

Gene References into Functions

It was shown that MCP2 was able to activate the NF-kappaB signaling pathway inducing the epithelial-mesenchymal transition (EMT) and promoting the migration and invasion of ESCC cells in vitro. PMID:29148603
Transcriptome analysis identified several novel IPF-related genes. Among them, CCL8 is a candidate molecule for the differential diagnosis and prediction of survival. PMID:28057004
Findings exemplify how gradients of chemoattractive factors such as CCL8, drive metastasis and suggest that interference with their operation may provide means for breast cancer management. PMID:27181207
Detecting expression changes in TLR4 and MCP2 in the peripheral blood is a feasible method for predicting the occurrence of abortion in women of child-bearing age PMID:27173235
Dermal fibroblast CCL8 promotes melanoma metastasis. PMID:26320180
Authors show that the previously observed downregulation of hsa-miR-92a and upregulation of CCL8 during human cytomegalovirus latent infection of myeloid cells are intimately linked via the latency-associated expression of cytomegalovirus UL111A. PMID:25253336
CCL8 is an antimicrobial protein with bacteriocidal activity against E. coli. PMID:12949249
Results indicate that the induction of MCP-2/CCL8 by mycobacteria is dependent on the activation of TLR2/PI3K/Akt signaling pathway. PMID:23418602
Macrophage Colony Stimulating Factor and Monocyte Chemoattractant Protein are elevated in sera of intrinsic asthmatics compared to normal controls. PMID:21945122
genetic polymorphhism is associated with a risk of death for non-small cell lung cancer in Chinese PMID:21514686
Cytokine treatment increases mRNA stability only for chemokines CCL2 and CCL8 in airway epithelium, and transient silencing and overexpression of human antigen R affects only chemokine CCL2 and CCL8 expression in primary and transformed epithelial cells. PMID:21220697
CCL8/MCP-2 is a target for mir-146a in HIV-1 infected microglia, as overexpression of mir-146a prevented HIV-induced secretion of MCP-2 chemokine PMID:20181935
TRAIL pretreatment of endothelial cells down-modulated mRNA steady-state levels of several TNF-alpha-induced chemokines, and it abrogated the TNF-alpha-mediated up-regulation of CCL8 and CXCL10, modulating leukocyte/endothelial cell adhesion PMID:15644410
Angiotensin II directly stimulates MCP-2 expression through AT1-receptors in activated macrophages PMID:17487826
CCL8 is a promising specific serum marker for the early and accurate diagnosis of graft-versus-host disease. PMID:18256320
A new finding is the differential distribution of CCL8 marker alleles and a haplotype in extreme severity subgroups of MS. PMID:18602166
IP-10 and MCP-2 are expressed in tuberculosis patients PMID:18684849
5-Amino-4-imidazole carboxamide riboside (AICAR) markedly increases UCP-2 expression and reduced both reactive oxygen species and prostacyclin synthase nitration. PMID:18835932
These data indicate that optimal induction and delivery of MCP-2/CCL8 is counteracted by converting this chemokine into a receptor antagonist, thereby losing its anti-tumoral potential. PMID:19224633
CCL8/MCP rs1133763 SNP, or other variants in linkage disequilibrium with this variant, likely do not influence the susceptibility to AD or FTLD in Caucasians. PMID:19415413

Hide All

Subcellular Location

Secreted.

Protein Families

Intercrine beta (chemokine CC) family

Tissue Specificity

Highest expression found in the small intestine and peripheral blood cells. Intermediate levels seen in the heart, placenta, lung, skeletal muscle, thymus, colon, ovary, spinal cord and pancreas. Low levels seen in the brain, liver, spleen and prostate.

Database Links

HGNC: 10635

UNIGENE: Hs.271387

KEGG: hsa:6355

STRING: 9606.ENSP00000378118

OMIM: 602283

Promotions