Recombinant Human C-C motif chemokine 24 (CCL24)

Code: CSB-RP059094h

Rate （N/A）
Review （0）

Size:

10μg50μg100μg200μg500μg1mg(1mg*1 or 500ug*2)

US$162

Quantity:

Express system: E.coli

Species: Homo sapiens (Human)

Tag Info: N-terminal 6xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

CCL24

Uniprot NO.

O00175

Research Area

Immunology

Alternative Names

CK-beta-6Eosinophil chemotactic protein 2Eotaxin-2Myeloid progenitor inhibitory factor 2 ;MPIF-2Small-inducible cytokine A24

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

27-119aa

Target Protein Sequence

VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

14.5kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Chemotactic for resting T-lymphocytes, and eosinophils. Has lower chemotactic activity for neutrophils but none for monocytes and activated lymphocytes. Is a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line. Binds to CCR3.

Gene References into Functions

Study showed that CCL24 was upregulated in hepatocellular carcinoma (HCC) tissues and correlated with poor prognosis in HCC patients . Also, CCL24 was associated with the metastatic potential of HCC cell lines and promoted proliferation, migration, and invasion. PMID:28042950
Mean eotaxin 2 concentrations in nasal fluid in patients with perennial allergic rhinitis and nonallergic and allergic chronic rhinosinusitis with nasal polyps patients were significantly higher in comparison to control subjects. PMID:28587510
HMGB1 did not elicit chemotaxis of human eosinophils alone and had no effect in combination with the eosinophil chemotactic agent, eotaxin-2 (CCL24). PMID:25774667
these data suggest that CCL26 and CCL24 are likely involved in the pathogenesis of chronic nasal hypereosinophilia, with a complex cooperation and different involvement of the various members of eotaxin family. PMID:24989688
Pregnancy associated environments increased local CCL24/CCR3, supporting the process of decidualization in human early pregnancy. PMID:23696919
Phosphodiesterase 4 inhibitors, rolipram and RO-20-1724 have no effect on CCL24 expression in human primary bronchial epithelial cells. PMID:22946025
Study shows that CCL24 levels were significantly increased in age-related macular degeneration (AMD) patients despite Avastin treatment as compared with normal controls and those without Avastin. PMID:23025269
CCR3 is differentially expressed on inflammatory cells in rheumatoid arthritis, while eotaxin-2, a potent CCR3 agonist, is differentially expressed in active disease. PMID:20659406
stimulates lung fibroblast proliferation and collagen synthesis PMID:20143648
alters eosinophil integrin function via mitogen-activated protein kinases PMID:12034562
Intradermal injection of CCL24 induces recruitment of eosinophils, basophils, neutrophils, and macrophages as well as features of early- and late-phase allergic reactions in atopic and nonatopic volunteers. PMID:12193745
Plasma eotaxin-2 concentrations differed in asthmatic patients with respect to aspirin intolerance and tolerance, indicating that eotaxin-2 may be differentially up-regulated according to aspirin intolerance. PMID:16304252
Our results suggest that Eo2 +179T>C and Eo2 +275C>T of eotaxin-2 might be associated with the susceptibility of ulcerative colitis. PMID:16391516
These data support the idea that CCL24/eotaxin-2 is part of the mechanism of CD4 lymphocyte activation paracrinally induced by Nef. PMID:17630924
eotaxin-2 is a chemokine strongly associated with primary and metastatic tumors of colorectal origin PMID:17908961
the ability to produce eotaxin-2/CCL24 is acquired during the differentiation into eosinophilic lineage which is dependent on GATA-1 expression PMID:17917245
This protein is an eosinophil chemoattractant that is up-regulated by human rhinovirus infection in cultured bronchial epithelial cells. PMID:11467997