Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
5F7Collagenase stimulatory factorExtracellular domain matrix metalloproteinase inducer ;EMMPRINLeukocyte activation antigen M6OK blood group antigen;Tumor cell-derived collagenase stimulatory factor ;TCSF; CD147
Species
Homo sapiens (Human)
Expression Region
138-321aa
Target Protein Sequence
EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSH
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
18-28 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The production of the recombinant human basigin (BSG) is through the expression of the gene fragment mapping within amino acids 138-321 of the human BSG protein in E.coli. This partial-length recombinant BSG protein is tagged with a 6xHis motif at the N-terminus, which allows for purification of this fusion protein through metal affinity chromatography. Its purity is greater than 90% determined by SDS-PAGE. It migrated to the molecular weight band of approximately 25 kDa on the gel. The target protein BSG, also called CD147 or EMMPRIN, is important in vision, spermatogenesis, and other physiological phenomena. It also plays a significant role in the pathogenesis of numerous diseases, including cancer. Recent findings point out that BSG exerts a significant role in SARS-CoV-2 invasion as a binding partner for the SARS-CoV-2 spike protein.
