Abbreviation
Recombinant Mouse Tnf protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured in a cytotoxicity assay using L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 26.52-46.24 pg/mL.
②Measured by its binding ability in a functional ELISA.Immobilized Mouse Tnf at 2 μg/mL can bind Human TNFRSF1A (CSB-MP023977HU1). The EC50 is 5.832-6.608 ng/mL.
③Human TNFRSF1A (CSB-MP023977HU1) captured on Protein A Chip can bind Recombinant Mouse Tnf with an affinity constant of 1.24 nM as detected by MetaSPR Assay (WeSPRTM 200).
Alternative Names
Tumor necrosis factor; Cachectin; TNF-alpha; Tumor necrosis factor ligand superfamily member 2 (TNF-a); Tumor necrosis factor, membrane form Alternative names: N-terminal fragment (NTF); Intracellular domain 1 (ICD1); Intracellular domain 2 (ICD2); C-domain 1; C-domain 2; Tumor necrosis factor, soluble form; Tnf; Tnfa, Tnfsf2
Species
Mus musculus (Mouse)
Expression Region
80-235aa
Target Protein Sequence
LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured in a cytotoxicity assay using L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 26.52-46.24 pg/mL.
-
Activity
Measured by its binding ability in a functional ELISA.Immobilized Mouse Tnf at 2 μg/mL can bind Human TNFRSF1A (CSB-MP023977HU1). The EC50 is 5.832-6.608 ng/mL.
-
Activity
Human TNFRSF1A (CSB-MP023977HU1) captured on Protein A Chip can bind Recombinant Mouse Tnf with an affinity constant of 1.24 nM as detected by MetaSPR Assay (WeSPRTM 200).
Description
TNF-α drives apoptosis, inflammation, and immune cell activation through TNFR1 and TNFR2, making precise control of its bioactivity essential for mechanistic studies of cytokine signaling and tumor immunology. This mammalian-expressed fragment spanning residues 80–235 demonstrates potent cytotoxic activity in L-929 fibroblast assays with an ED50 of 26.52–46.24 pg/mL and binds human TNFRSF1A with an EC50 of 5.832–6.608 ng/mL and a KD of 1.24 nM, confirming receptor engagement at physiologically relevant concentrations suitable for NF-κB and MAPK pathway activation studies. The endotoxin level below 1.0 EU/μg prevents LPS-driven artifacts in primary immune cell assays, supporting use in macrophage polarization experiments, T-cell co-stimulation protocols, and in vivo inflammation models where TNF-α–specific effects must be isolated from innate immune contamination. Purity exceeding 95% by SDS-PAGE, combined with quantitative receptor-binding validation, provides a reliable basis for antibody development, ELISA standardization, and dose-response studies in cancer immunotherapy research.