Recombinant Macaca mulatta Interferon gamma (IFNG) (Active)

In Stock
Code: CSB-MP011050MOW
Size:
20ug
20ug100ug1mg
US$102
Quantity:
Express system: Mammalian cell
Species: Macaca mulatta (Rhesus macaque)
Tag Info: C-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Rhesus macaque IFNG protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Macaca mulatta IFNG at 2 μg/mL can bind anti-IFNG recombinant antibody (CSB-RA011050MA1HU).The EC50 is 35.23-38.98 ng/mL.
Target Names
IFNG
Uniprot NO.
Alternative Names
Interferon gamma; IFN-gamma; IFNG
Species
Macaca mulatta (Rhesus macaque)
Source
Mammalian cell
Expression Region
24-165aa
Target Protein Sequence
QDPYVKEAENLKKYFNAGDPDVADNGTLFLDILRNWKEESDRKIMQSQIVSFYFKLFKNFKDDQRIQKSVETIKEDINVKFFNSNKKKRDDFEKLTNYSVTDSNVQRKAVHELIQVMAELSPAAKIGKRKRSQMFRGRRASQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
18.1 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA.Immobilized Macaca mulatta IFNG at 2 μg/ml can bind anti-IFNG recombinant antibody (CSB-RA011050MA1HU).The EC50 is 35.23-38.98 ng/mL.
Description

Interferon gamma orchestrates macrophage activation, MHC class II upregulation, and antiviral defense, making it a central node in primate immune response studies. This recombinant rhesus macaque IFNG, spanning the complete mature protein sequence (aa 24–165), demonstrates quantifiable binding activity with an EC50 of 35.23–38.98 ng/mL in a functional ELISA against a recombinant anti-IFNG antibody, providing a validated basis for antibody development workflows including epitope mapping, ELISA standardization, and immunogen characterization. The endotoxin level below 1.0 EU/μg meets the contamination thresholds commonly required for cell-based assays where LPS artifacts would confound readouts of JAK-STAT signaling, macrophage polarization, or T-cell activation. Purity exceeding 95% by SDS-PAGE, combined with the mammalian expression platform, supports use in primary PBMC stimulation experiments, cytokine detection assay calibration, and non-human primate infection models where native glycosylation and folding are critical for receptor engagement.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Type II interferon produced by immune cells such as T-cells and NK cells that plays crucial roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation. Primarily signals through the JAK-STAT pathway after interaction with its receptor IFNGR1 to affect gene regulation. Upon IFNG binding, IFNGR1 intracellular domain opens out to allow association of downstream signaling components JAK2, JAK1 and STAT1, leading to STAT1 activation, nuclear translocation and transcription of IFNG-regulated genes. Many of the induced genes are transcription factors such as IRF1 that are able to further drive regulation of a next wave of transcription. Plays a role in class I antigen presentation pathway by inducing a replacement of catalytic proteasome subunits with immunoproteasome subunits. In turn, increases the quantity, quality, and repertoire of peptides for class I MHC loading. Increases the efficiency of peptide generation also by inducing the expression of activator PA28 that associates with the proteasome and alters its proteolytic cleavage preference. Up-regulates as well MHC II complexes on the cell surface by promoting expression of several key molecules such as cathepsins B/CTSB, H/CTSH, and L/CTSL. Participates in the regulation of hematopoietic stem cells during development and under homeostatic conditions by affecting their development, quiescence, and differentiation.
Gene References into Functions
  1. IFNgamma expression in colonic epithelial cells was regulated by TGFB1. PMID:25769244
  2. Higher KIR2DL4 copy numbers is associated with an increased IFN-gamma production in NK cell subsets in SIV-infected Mamu-A*01-negative rhesus macaques. PMID:23449795
  3. Data show that viral set-point in simian immunodeficiency virus diseasewas is associated with expression of interferon gamma -stimulated genes. PMID:17719201
  4. Low Sociable animals showed alterations in lymph node expression of the immunoregulatory cytokine interferon-gamma. PMID:18068331

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Type II (or gamma) interferon family
Tissue Specificity
Released primarily from activated T lymphocytes.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products