Abbreviation
Recombinant Rhesus macaque IFNG protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Macaca mulatta IFNG at 2 μg/mL can bind anti-IFNG recombinant antibody (CSB-RA011050MA1HU).The EC50 is 35.23-38.98 ng/mL.
Alternative Names
Interferon gamma; IFN-gamma; IFNG
Species
Macaca mulatta (Rhesus macaque)
Expression Region
24-165aa
Target Protein Sequence
QDPYVKEAENLKKYFNAGDPDVADNGTLFLDILRNWKEESDRKIMQSQIVSFYFKLFKNFKDDQRIQKSVETIKEDINVKFFNSNKKKRDDFEKLTNYSVTDSNVQRKAVHELIQVMAELSPAAKIGKRKRSQMFRGRRASQ
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA.Immobilized Macaca mulatta IFNG at 2 μg/ml can bind anti-IFNG recombinant antibody (CSB-RA011050MA1HU).The EC50 is 35.23-38.98 ng/mL.
Description
Interferon gamma orchestrates macrophage activation, MHC class II upregulation, and antiviral defense, making it a central node in primate immune response studies. This recombinant rhesus macaque IFNG, spanning the complete mature protein sequence (aa 24–165), demonstrates quantifiable binding activity with an EC50 of 35.23–38.98 ng/mL in a functional ELISA against a recombinant anti-IFNG antibody, providing a validated basis for antibody development workflows including epitope mapping, ELISA standardization, and immunogen characterization. The endotoxin level below 1.0 EU/μg meets the contamination thresholds commonly required for cell-based assays where LPS artifacts would confound readouts of JAK-STAT signaling, macrophage polarization, or T-cell activation. Purity exceeding 95% by SDS-PAGE, combined with the mammalian expression platform, supports use in primary PBMC stimulation experiments, cytokine detection assay calibration, and non-human primate infection models where native glycosylation and folding are critical for receptor engagement.