Abbreviation
Recombinant Human IL12P40&IL12P35 Heterodimer protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
≤10 EU/mg by the LAL method
Activity
Measured by its ability to induce Interferon gamma secretion by human natural killer lymphoma NK-92 cells. The ED50 for this effect is <0.5 ng/mL.
Alternative Names
Interleukin-12 subunit alpha; IL-12A; Cytotoxic lymphocyte maturation factor 35 kDa subunit; CLMF p35; IL-12 subunit p35; NK cell; IL12A ; NKSF1 stimulatory factor chain 1
Species
Homo sapiens (Human)
Expression Region
23-328aa(IL12P40)&23-219aa(IL12P35)
Target Protein Sequence
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS&RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Heterodimer
Tag Info
Tag free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Description
IL-12 orchestrates Th1 polarization and NK cell activation through a tightly regulated heterodimeric architecture, making functional integrity essential for mechanistic studies of cell-mediated immunity. This tag-free heterodimer, spanning residues 23–328 of IL-12p40 and 23–219 of IL-12p35, demonstrates potent bioactivity with an ED50 below 0.5 ng/mL in NK-92 interferon-gamma secretion assays, directly validating its capacity to drive downstream JAK-STAT signaling and effector cytokine production. The endotoxin specification of ≤10 EU/mg meets the quality thresholds commonly required for primary immune cell activation studies, PBMC differentiation experiments, and in vivo inflammation models where LPS contamination would confound cytokine-specific responses. Purity exceeding 95% by SDS-PAGE, combined with the demonstrated NK cell activation profile, supports use as a positive control in cytokine detection platforms and as a functional reference in antibody validation workflows targeting the assembled p70 heterodimer.