Abbreviation
Recombinant Human IL12B&IL12A Heterodimer protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human IL12B&IL12A at 1 μg/mL can bind Anti-IL12/IL23 recombinant antibody (CSB-RA011587MA1HU), the EC50 is 1.042-1.545 ng/mL.
Alternative Names
Interleukin-12 subunit alpha;IL-12A;Cytotoxic lymphocyte maturation factor 35 kDa subunit;CLMF p35;IL-12 subunit p35;NK cell stimulatory factor chain 1;NKSF1;IL12A;NKSF1;Interleukin-12 subunit beta;IL-12B;Cytotoxic lymphocyte maturation factor 40 kDa subunit;CLMF p40;L-12 subunit p40;NK cell stimulatory factor chain 2;NKSF2;IL12B;NKSF2;IL12;
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
23-328aa(IL12B) & 23-219aa(IL12A)
Target Protein Sequence
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS&RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
39.7 kDa & 27.2 kDa
Protein Length
Heterodimer
Tag Info
C-terminal 10xHis-tagged & C-terminal Flag-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel)Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human IL12B&IL12A at 1 μg/ml/mL can bind Anti-IL12/IL23 recombinant antibody(CSB-RA011587MA1HU), the EC50 is 1.042-1.545 ng/mL.
Description
IL-12, the heterodimeric cytokine formed by IL-12B (p40) and IL-12A (p35), plays a central role in bridging innate and adaptive immunity by driving Th1 polarization, NK cell activation, and IFN-γ production. This recombinant human IL-12 heterodimer, expressed in mammalian cells and spanning residues 23–328 (IL-12B) and 23–219 (IL-12A) with C-terminal 10×His and Flag tags, preserves the native subunit pairing required for receptor engagement and downstream JAK2/TYK2–STAT4 signaling studies. Functional ELISA confirms binding to an anti-IL-12/IL-23 recombinant antibody with an EC₅₀ of 1.042–1.545 ng/mL, supporting use as a coating antigen for antibody development and validation or as a reference standard in cytokine detection assays. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the stringent criteria needed for PBMC and primary T-cell activation assays, where LPS-driven artifacts could otherwise confound cytokine-attributable responses.
