Recombinant Human Complement component C1q receptor (CD93), partial (Active)

In Stock
Code: CSB-MP865099HU
Size:
20ug
20ug100ug1mg
US$114
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: C-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human CD93 protein, partial (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CD93 at 2 μg/mL can bind Human IGFBP7 (CSB-MP620956HUd9), the EC50 is 20.34-26.92 ng/mL.Measured by its binding ability in a functional ELISA. Immobilized Human CD93 at 2 μg/mL can bind Anti-CD93 recombinant antibody (CSB-RA865099MA1HU), the EC50 is 0.6639-1.173 ng/mL.
Target Names
CD93
Uniprot NO.
Alternative Names
(C1q/MBL/SPA receptor)(CDw93)(Complement component 1 q subcomponent receptor 1)(Matrix-remodeling-associated protein 4)(CD_antigen: CD93)(C1qR)(C1qR(p))(C1qRp)
Molecular Characterization
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
22-580aa
Target Protein Sequence
TGADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
60.1 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human CD93 at 2 μg/ml can bind Anti-CD93 recombinant antibody (CSB-RA865099MA1HU), the EC50 is 0.6639-1.173 ng/mL.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human CD93 at 2 μg/ml can bind Human IGFBP7 (CSB-MP620956HUd9), the EC50 is 20.34-26.92 ng/mL.
  • The purity of CD93 was greater than 90% as determined by SEC-HPLC
Description

CD93 plays a critical role in angiogenesis, cell adhesion, and tumor microenvironment remodeling, making it an emerging target in cancer immunology and anti-angiogenic drug discovery. This recombinant human CD93 encompasses the extracellular region (aa 22–580), expressed in mammalian cells to preserve native glycosylation and conformational integrity essential for faithful ligand-receptor interactions. Functional ELISA validation confirms robust binding to both an anti-CD93 recombinant antibody (EC50 of 0.66–1.17 ng/mL) and human IGFBP7 (EC50 of 20.34–26.92 ng/mL), providing a reliable basis for receptor-ligand interaction assays, competitive inhibition studies, blocking antibody screening, and therapeutic antibody epitope mapping. With purity exceeding 90% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this C-terminal His-tagged protein satisfies the quality criteria typical for SPR or BLI affinity characterization and cell-based functional assays in cancer research.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor (or element of a larger receptor complex) for C1q, mannose-binding lectin (MBL2) and pulmonary surfactant protein A (SPA). May mediate the enhancement of phagocytosis in monocytes and macrophages upon interaction with soluble defense collagens. May play a role in intercellular adhesion.
Gene References into Functions
  1. Report increased CD93 expression in patients with chronic plaque psoriasis and propose the C allele of rs2749817 as a new risk allele for psoriasis. PMID:28421233
  2. Results show that CD93 and MMRN2 are co-expressed in the blood vessels of various tumors and their interaction modulates the angiogenic process. PMID:28912033
  3. These findings identify novel protein interactions involving CLEC14A, CD93 and CD248 with MMRN2 as targetable components of vessel formation PMID:28671670
  4. CD93 and Other Plasma Cell Survival Factor Genes Associated with Measles-Specific Antibody Response after Vaccination PMID:27529750
  5. Soluble expression of disulfide-bonded C-type lectin like domain of human CD93 in the cytoplasm of Escherichia coli. The recombinant protein could alter LPS pro-inflammatory activity on THP1 cells. PMID:27742562
  6. Vascular CD93 expression is elevated in nasopharyngeal carcinoma and is correlated with T classification, N classification, distant metastasis, clinical stage and poor prognosis (all P < 0.05). In addition, overexpression of CD93 promoted angiogenesis in vitro. PMID:27255994
  7. both transmembrane and soluble CD93 are overexpressed in patients with neovascular Age-Related Macular Degeneration. PMID:27859225
  8. Elevated serum sCD93 levels reflected exacerbated status of allergic diseases, including CSU [chronic spontaneous urticaria ], AR[allergic rhinitis], and asthma. ICS [inhaled corticosteroid] use significantly diminished serum sCD93 levels in steroid-naive patients with BA[Bronchial asthma]. This result may suggest sCD93 in serum as a therapeutic marker for allergic inflammation. PMID:28332366
  9. Data show that CD93 antigen proved to be phosphorylated on tyrosine 628 and 644 following cell adhesion on laminin through dystroglycan. PMID:26848865
  10. CD93 expression identifies a predominantly cycling, non-quiescent leukemia-initiating cell population in MLL-rearranged AML, providing opportunities for selective targeting and eradication of LSCs. PMID:26387756
  11. The T/T genotype of SNP rs2749817 of CD93 is associated with disseminated cancer. PMID:26008729
  12. CD93 is a key regulator of glioma angiogenesis and vascular function, acting via cytoskeletal rearrangements required for cell-cell and cell-matrix adhesion. PMID:26363010
  13. These data support a mechanism whereby gC1qR plays an important role in HPV-16 E2-induced human cervical squamous carcinoma cell apoptosis via a mitochondria-dependent pathway. PMID:25288439
  14. The data indicate that gC1qR inhibits viability, migration and proliferation of cervical squamous cells carcinoma via the p38 MAPK signalling pathway. PMID:23052251
  15. Antibody-dependent enhancement of parvovirus B19 involves an alternative mechanism mediated by the heat-sensitive complement factor C1q and its receptor, CD93. PMID:24807719
  16. Expression of CD93 on the lymphocyte population of peripheral blood cells from infants at 1 month after birth was also significantly decreased, compared with that for neonatal umbilical cord blood. PMID:24033555
  17. HPV 16 E2 induces apoptosis by silencing the gC1qR gene or inhibiting p38 MAPK/JNK signalling in cervical squamous cell carcinoma PMID:23651874
  18. These data support a mechanism whereby gC1qR induces apoptosis through the mitochondrial and p53-dependent pathways in cervical squamous cell carcinoma. PMID:23268996
  19. soluble EGF-like domain containing CD93 protein is a novel angiogenic factor acting on the endothelium PMID:23272129
  20. [review] Following a comprehensive summary of CD93 expression patterns, this review focuses on recent findings that address the putative function of CD93 in inflammation and innate immunity. PMID:22206251
  21. Data show that Pic, a class 2 SPATE protein produced by Shigella flexneri 2a targets a broad range of human leukocyte glycoproteins including CD43, CD44, CD45, CD93, CD162 and the surface-attached chemokine fractalkine. PMID:21768350
  22. Results suggest that the plasma concentration of soluble CD93 is a potential novel biomarker for Coronary Artery Disease (CAD), including MI. PMID:21332844
  23. expression on naive T lymphocytes (CD4(+)CD45RA (+) cells) in human neonatal umbilical cord blood PMID:20512406
  24. both B1 receptor and gC1q receptor are involved in the vascular leakage induced by hereditary and acquired angioedema plasma. PMID:19796797
  25. To clarify the cellular and molecular properties of C1qRp it has been demonstrated that C1q does not show enhanced binding to C1qRp-transfected cells, is not a receptor for C1q, and is identical to CD93 with functions relevant to intercellular adhesion. PMID:11994479
  26. C1qRp defines a new human stem cell population with hematopoietic and hepatic potential PMID:12140365
  27. O-glycosylation is important in the stable cell surface expression of C1qRP/CD93 PMID:12891708
  28. Taken together, these findings indicate that the expression of the CD93 molecule identified by CD93 mAb (mNI-11) is dramatically decreased on U937 cells with apoptotic properties PMID:18094537
  29. RNAi-mediated suppression of gC1qR/p32 markedly reduced HTNV binding and infection in human lung epithelial A549 cells PMID:18834607

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Tissue Specificity
Highly expressed in endothelial cells, platelets, cells of myeloid origin, such as monocytes and neutrophils. Not expressed in cells of lymphoid origin.
Database Links

HGNC: 15855

UNIGENE: Hs.97199

KEGG: hsa:22918

STRING: 9606.ENSP00000246006

OMIM: 120577

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products