Recombinant Human Arginase-1 (ARG1) (Active)

In Stock Discontinued

Code: CSB-AP005611HU

Rate （N/A）
Review （0）

Size:

10ug50ug500ug1mg(1mg*1 or 500ug*2)

US$348

Quantity:

Express system: Mammalian cell

Species: Homo sapiens (Human)

Tag Info: C-terminal 6xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Activity

Specific activity as determined by the production of urea during the hydrolysis of arginine is greater than 30000 pmol/min/?g.

Target Names

ARG1

Uniprot NO.

P05089

Research Area

Signal Transduction

Alternative Names

A I; Al; ARG 1; arg1; ARGI1_HUMAN; Arginase 1; Arginase liver; Arginase type I; Arginase; liver; Arginase-1; Arginase1; Liver type arginase; Liver-type arginase; Type I arginase

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

1-322aa

Target Protein Sequence

MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

35.6 kDa

Protein Length

Full Length

Tag Info

C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, 20% Glycerol, 1 mM DTT, pH 7.4

Storage

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Lead Time

Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Shelf Life

The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Key element of the urea cycle converting L-arginine to urea and L-ornithine, which is further metabolized into metabolites proline and polyamides that drive collagen synthesis and bioenergetic pathways critical for cell proliferation, respectively; the urea cycle takes place primarily in the liver and, to a lesser extent, in the kidneys.; Functions in L-arginine homeostasis in nonhepatic tissues characterized by the competition between nitric oxide synthase (NOS) and arginase for the available intracellular substrate arginine. Arginine metabolism is a critical regulator of innate and adaptive immune responses. Involved in an antimicrobial effector pathway in polymorphonuclear granulocytes (PMN). Upon PMN cell death is liberated from the phagolysosome and depletes arginine in the microenvironment leading to suppressed T cell and natural killer (NK) cell proliferation and cytokine secretion. In group 2 innate lymphoid cells (ILC2s) promotes acute type 2 inflammation in the lung and is involved in optimal ILC2 proliferation but not survival. In humans, the immunological role in the monocytic/macrophage/dendritic cell (DC) lineage is unsure.

Gene References into Functions

study of the significance of heat activation and the role of metal ions in human arginase PMID:30282613
TGF-beta1 and arginase-1 may play important roles in determining long-term graft survival. PMID:30074212
These results showed that arginase controlled sFlt-1 elevation to some extent. PMID:29548823
ARG1 gene polymorphisms and their association in individuals with essential hypertension in Pakistan has been presented. PMID:29756997
A subset of well-differentiated hepatocellular carcinomas are arginase-1 negative. PMID:28970136
The data in this study suggest that arginase I inhibition potentially represents a novel therapeutic target for the prevention and/or treatment of bronchopulmonary dysplasia-associated pulmonary hypertension. PMID:27895230
this study shows that infiltrating macrophages expressing Arg1 are present in active allergic contact dermatitis lesions PMID:28747341
High arginase expression is associated with glioblastoma. PMID:27006175
Report the value of Arg-1 in distinguishing HepPar-1-positive prostatic carcinoma from hepatocellular carcinoma at metastatic sites or cases of liver metastasis from prostate carcinoma. PMID:27184483
AEG-1 is positively activated in the tumorigenesis and deterioration of NSCLC. PMID:28152520
Arginase-1 expression is common (62.5%) in hepatoid adenocarcinoma and hence it is not useful in distinguishing hepatocellular carcinoma from hepatoid adenocarcinoma. PMID:27137985
Arginase 1 was highly expressed by tumor-associated Gr1+ microglia and macrophages. PMID:27936099
The authors report here that Candida albicans blocks nitric oxide production in human-monocyte-derived macrophages by induction of host arginase activity. PMID:28119468
Evidence for a negative association of arginase I with job strain and positive association with job control and social support in females. PMID:28403218
Two argininemia patients were initially diagnosed by tandem mass spectrometry in newborn screening. Mutation analysis of the ARG1 gene was performed by direct sequencing.Two missense mutations, p.D100N and p.R71T, in Patient-1 were predicted to lower the stability of arginase Iota by analysis of 3D crystal structure, while two nonsense mutations, p.G12X and p.E42X, in Patient-2 were predicted to lead to truncated protein. PMID:28089752
The results of this study suggested a novel relationship exists between ARG1, neutrophil-lymphocyte ratio , and stroke severity which may help guide future mechanistic studies of post-stroke immune suppression. PMID:26515089
This study provides a molecular mechanism of the pathogenesis of systemic lupus erythematosus by demonstrating an Arg-1-dependent effect of myeloid-derived suppressor cells in the development of TH17 cell-associated autoimmunity. PMID:27009269
ARG1 rs2781659 AA and rs2781667 TT genotypes were associated with lower IIEF scores (increased severity) in clinical erectile dysfunction (ED), whereas ARG1 GTCC haplotype is associated with higher IIEF scores in clinical ED, thus suggesting a genetic contribution of ARG1 variations to ED PMID:26537638
These results showed that alterations in the expression levels of Arg I and iNOS in the peripheral T cells and peripheral nodes of HIV infected patients are associated with disease progression in these patients. PMID:26647762
Increased ARG1 expression in macrophages after a single radiotherapy dose is an independent prognostic factor of skin toxicities. PMID:26061397
Arginase inhibition arrests human pulmonary artery smooth muscle cells in the G1/G0-phase under hypoxic conditions. PMID:26126810
Arginase from neutrophils can modulate nitric oxide production from activated macrophages which may affect the course of infection by intracellular bacteria. PMID:26119192
Overexpression and elevated activity of arginase I are involved in tobacco-induced pulmonary endothelial dysfunction. PMID:25889611
This method not only solved the problem of obtaining a large amount of arginase, but also provided a promising alternative for the future industrial production of L-Orn. PMID:26227111
the combination of high levels of CD14, FOXP3, and ARG1 mRNAs identified a small group of patients with excellent event-free and overall survival. PMID:26161395
Overexpression of Arg1 in the CNS of transgenic mice significantly reduced tau pathology. PMID:26538654
data indicate that helminth coinfection induces arginase-1-expressing type 2 granulomas, thereby increasing inflammation and TB disease severity. PMID:26571397
The data exclude a prognostic role of IL-10 and ARG-1 in metastatic neuroblastoma. PMID:25961062
Arginase activity increases in peripheral blood of patients with intestinal schistosomiasis. PMID:25786588
Data indicate that arginase-1 showed positivity in 2 ampullary region carcinomas and diffuse positivity in 1 duodenal adenocarcinoma. PMID:26030248
Arg1 induced accumulation of autophagosomes in MDA-MB-231 cells. PMID:25501824
Arg1 and PD-L1 are dynamically modulated upon neutrophil migration into human airways, and, Arg1, but not PD-L1, contributes to early neutrophil-driven T cell suppression in cystic fibrosis, likely hampering resolution of infection and inflammation. PMID:25926674
These results suggest that ARG1 and GABA influence both neural development and neuroblastoma and that benzodiazepines in clinical use may have potential applications for neuroblastoma therapy. PMID:25437558
Arg1 expression is decreased, and Arg2 expression is increased in the newborn congenital obstructive nephropathy and in the mouse model. PMID:25205225
rs2781666 may be associated with protection against pulmonary hypertension in preterm neonates with bronchopulmonary dysplasia PMID:24919409
The plasma levels of arginase I was higher in patients with DCL. PMID:25124926
Novel variants in the ARG1 locus associated with CRP levels in cardiovascular disease in a Korean population. [Meta-analysis] PMID:24763700
Arginase I levels are decreased in the plasma of pediatric patients with atopic dermatitis. PMID:25027824
Arginase activity was higher in cord blood of gestational diabetes mellitus mothers as opposed to the control group. PMID:24376824
Our results suggest that serum ARG and CRP together can efficiently diagnose Head and neck squamous cell carcinoma. PMID:24715304
Serum arginase I might regulate serum L-arginine and 3-nitrotyrosine via L-arginine. PMID:24060156
The independent associations of arginase I with urinary 8-OHdG and serum insulin may reflect its involvement in oxidative stress and diabetes mellitus. PMID:24005081
Arginase-1 mRNA expression correlates with myeloid-derived suppressor cell levels in peripheral blood of NSCLC patients. PMID:23850196
Both arginase-1 and HepPar-1 are effective markers of hepatocellular differentiation PMID:24281232
This study demonistrated that Five novel mutations in ARG1 gene in Chinese patients of argininemia. PMID:23859858
Glypican 3 and arginase-1 are the most reliable markers for identifying scirrhous hepatocellular carcinoma. PMID:23348905
Enzymes that are directly involved in the formation of urea are expressed in ocular tissues. PMID:23740519
Results show that the positively charged state of arginine is stable in the active site of arginase I, with that stabilization facilitated by the presence of hydroxide. PMID:23327293
The tumor suppressive function of arginase-I in both infiltrating and circulating myeloid-derived suppressor cells is a downstream target of activated STAT3. PMID:23454751
results suggest that Arg-1 may play a tumor suppressive role in HCC and could be a new, promising prognostic biomarker for HCC patients PMID:23505904

Hide All

Subcellular Location

Cytoplasm. Cytoplasmic granule.

Protein Families

Arginase family

Tissue Specificity

Within the immune system initially reported to be selectively expressed in granulocytes (polymorphonuclear leukocytes [PMNs]). Also detected in macrophages mycobacterial granulomas. Expressed in group2 innate lymphoid cells (ILC2s) during lung disease.

Database Links

HGNC: 663

UNIGENE: Hs.440934

KEGG: hsa:383

STRING: 9606.ENSP00000357066

OMIM: 207800

Promotions