Abbreviation
Recombinant Human ARG1 protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Human ARG1 at 2 μg/mL can bind Anti-ARG1 recombinant antibody (CSB-RA002005MA1HU). The EC50 is 2.291-3.018 ng/mL. ②ARG1 Recombinant Monoclonal Antibody (CSB-RA002005MA1HU) captured on Protein A Chip can bind Recombinant Human ARG1 with an affinity constant of 0.918 nM as detected by MetaSPR Assay (WeSPRTM 200).
Alternative Names
Arginase-1; EC 3.5.3.1; Liver-type arginase; Type I arginase
Species
Homo sapiens (Human)
Expression Region
1-322aa
Target Protein Sequence
MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human ARG1 at 2 μg/ml can bind Anti-ARG1 recombinant antibody (CSB-RA002005MA1HU). The EC50 is 2.291-3.018 ng/mL.
-
Activity
ARG1 Recombinant Monoclonal Antibody (CSB-RA002005MA1HU) captured on Protein A Chip can bind Recombinant Human ARG1 with an affinity constant of 0.918 nM as detected by MetaSPR Assay (WeSPRTM 200).
Description
Arginase-1 catalyzes the hydrolysis of L-arginine to L-ornithine and urea, a reaction central to both hepatic nitrogen metabolism and immune regulation in tumor microenvironments where ARG1 depletion of arginine suppresses T-cell proliferation. This full-length recombinant protein (aa 1–322) demonstrates specific antibody binding with an EC50 of 2.291–3.018 ng/mL in functional ELISA and a binding affinity of 0.918 nM by surface plasmon resonance, confirming proper folding and epitope accessibility that supports its use as a positive control in enzyme-linked assays and for inhibitor screening campaigns. The C-terminal 10×His tag preserves the native N-terminus and active site architecture, providing a suitable basis for kinetic parameter analysis, IC50 determination in drug candidate evaluation, and substrate specificity profiling. Purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg meet the quality thresholds commonly required for accurate specific activity measurements and structural studies including crystallography.
