Abbreviation
Recombinant Human IL36G protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined by its ability to induce IL-8 secretion in A431 human epithelial carcinoma cells is 5-20 ng/ml.
Alternative Names
IL 1 epsilon; IL 1 related protein 2; IL 1(EPSILON); IL 1F9; IL 1H1; IL 1RP2; IL-1 epsilon; IL-1-related protein 2; IL-1F9; IL-1H1; IL-1RP2; IL1E; Il1f9; IL1F9_HUMAN; IL1H1; IL1RP2; IL36 gamma; IL36G; Interleukin 1 epsilon; Interleukin 1 family member 9; Interleukin 1 homolog 1; Interleukin 1 related protein 2; Interleukin 36 gamma; Interleukin-1 epsilon; Interleukin-1 family member 9; Interleukin-1 homolog 1
Species
Homo sapiens (Human)
Expression Region
18-169aa
Target Protein Sequence
SMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm Filtered 20 mM Tris-HCl, 100 mM NaCl, 0.1 mM EDTA, pH 8
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Datasheet & COA
Please contact us to get it.
Description
IL-36γ is a pro-inflammatory IL-1 family cytokine that signals through IL-1RL2/IL-1RAcP to activate NF-κB and MAPK pathways, making it a key mediator in epithelial immune responses and psoriasis-related inflammation. This tag-free recombinant human IL-36G, covering the full mature sequence (aa 18–169), demonstrates robust signaling potency with an ED50 of 5–20 ng/mL in an IL-8 secretion assay using A431 human epithelial carcinoma cells, providing a reliable basis for cell-based activation assays, NF-κB and MAPK pathway dissection, and use as a reference standard in cytokine detection platforms. The protein's endotoxin level of less than 1.0 EU/μg satisfies the stringent criteria needed to prevent LPS-driven artifacts in sensitive immune cell experiments, including in vivo inflammation models and antibody development workflows such as ELISA coating or positive controls. Purity exceeding 95% by SDS-PAGE, combined with this low endotoxin profile, supports use in functional studies where signal specificity is essential.
