Recombinant Human Interleukin-1 receptor antagonist protein (IL1RN) (Active)

CSB-AP004601HU
Size:
10ug
10ug50ug500ug1mg
US$78
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: Tag-Free
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined by its ability to inhibit IL-1 beta induced NF-kB signaling in 293-IL1 Res cells is 13.2 ng/mL.
Uniprot NO.
Research Area
Immunology
Alternative Names
DIRA; F630041P17Rik; ICIL 1RA; ICIL-1RA; ICIL1RA; IL-1ra; IL-1ra3; IL-1RN; IL1 inhibitor; IL1F3; IL1RA; IL1RA_HUMAN; IL1RN (IL1F3); IL1RN; Interleukin 1 receptor antagonist; Interleukin-1 receptor antagonist protein; Intracellular IL 1 receptor antagonist type II; Intracellular interleukin 1 receptor antagonist (icIL 1ra); IRAP; MGC10430; MVCD4; Type II interleukin 1 receptor antagonist
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
26-177aa
Target Protein Sequence
RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Mol. Weight
17.26 kDa
Protein Length
Full Length of Mature Protein
Tag Info
Tag-Free
Buffer
Lyophilized from a 0.2 μm filtered 20mM PB, 8% Trehalose, 4% Mannitol, 50mM NaCl, 0.05% Tween80, pH7.5.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • Recombinant Human Interleukin-1 receptor antagonist protein (IL1RN) (Active)
Description

Recombinant Human Interleukin-1 receptor antagonist protein (IL1RN) gets produced in E. coli and contains the complete mature protein spanning amino acids 26 to 177. This tag-free protein achieves purity levels exceeding 95% when measured by SDS-PAGE, which appears to ensure solid quality for research applications. The biological activity of IL1RN has been confirmed, showing an ED50 of 13.2 ng/mL based on its capacity to block IL-1 beta induced NF-kB signaling in 293-IL1 Res cells. Endotoxin levels stay below 1.0 EU/µg, as measured through the LAL method.

Interleukin-1 receptor antagonist (IL1RN) serves as a key protein that works to block interleukin-1 activities by attaching to its receptor, effectively stopping signal transmission. It likely plays a major role in controlling immune and inflammatory responses, which makes it particularly important for research into immune regulation and inflammatory diseases. Studying how IL1RN interacts with its receptor may help clarify the pathways involved in inflammation and immune response control.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. IL-1β Signaling Pathway Inhibition Studies

This recombinant IL1RN is confirmed to be biologically active (ED₅₀ 13.2 ng/mL in NF-κB inhibition) and suitable for IL-1β signaling inhibition studies. However, the E. coli expression produces a non-glycosylated protein, which may affect stability or half-life compared to native glycosylated IL1RN. Researchers should validate that inhibition kinetics and duration match mammalian-expressed IL1RN, particularly in long-term assays. The competitive antagonism mechanism is well-supported by the demonstrated activity.

2. Anti-IL1RN Antibody Development and Validation

This high-purity, tag-free IL1RN serves as an excellent antigen for antibody development. However, antibodies generated against this E. coli-expressed protein may not recognize glycosylated epitopes present in native IL1RN from human sources. Comprehensive validation should include testing against mammalian-expressed or naturally occurring IL1RN to ensure recognition of physiological forms. The confirmed bioactivity supports the development of function-blocking antibodies.

3. Inflammatory Response Modulation in Cell Culture Models

The protein is appropriate for inflammation studies, but the ED₅₀ was determined in 293-IL1 Res cells, which may not fully represent primary immune cells or complex inflammatory environments. Researchers should validate optimal concentrations in primary macrophages, fibroblasts, or other relevant cell types. The low endotoxin ensures specific attribution of effects to IL1RN activity rather than contamination.

4. Protein-Protein Interaction Studies

The biologically active IL1RN is suitable for interaction studies with IL-1 receptors, but the non-glycosylated state may alter binding kinetics compared to native IL1RN. While the tag-free design ensures authentic interactions, binding affinity should be validated against mammalian-expressed IL1RN for precise measurements. The mature protein sequence contains all necessary domains for receptor binding.

5. Cytokine Network Analysis in Co-culture Systems

The protein can be used in co-culture systems, but the E. coli expression and lack of glycosylation may affect diffusion and stability in complex 3D environments. Researchers should validate that IL-1β inhibition efficacy matches mammalian-expressed IL1RN, particularly in long-term co-cultures where protein stability becomes critical. The specific activity provides a good starting point for dose optimization.

Final Recommendation & Action Plan

This E. coli-expressed human IL1RN is a high-quality functional reagent with confirmed bioactivity, making it suitable for most proposed applications. However, researchers should account for its non-glycosylated state and validate key findings in physiologically relevant systems. For immediate use: employ it at 10-50 ng/mL based on the ED₅₀, but establish dose-response curves in each specific cell type and assay format. When developing antibodies, this protein is ideal for generating reagents, but validated against native IL1RN from inflammatory conditions to ensure recognition of physiological forms. For signaling studies, the tag-free design ensures authentic receptor interactions, but confirms inhibition kinetics in primary cells. In co-culture systems, monitor protein stability and replenish as needed for long-term experiments. The low endotoxin is particularly valuable for sensitive primary cell assays. Always include appropriate controls and consider that different cell types may exhibit varying sensitivity to IL1RN-mediated inhibition based on IL-1 receptor expression levels.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function
Inhibits the activity of interleukin-1 by binding to receptor IL1R1 and preventing its association with the coreceptor IL1RAP for signaling. Has no interleukin-1 like activity. Binds functional interleukin-1 receptor IL1R1 with greater affinity than decoy receptor IL1R2; however, the physiological relevance of the latter association is unsure.
Gene References into Functions
  1. PDE4B-deficient mice displayed an increased circulating IL-1Ra, suggesting a protective role of PDE4B inactivation in vivo. PMID:28383060
  2. Interleukin 1 receptor antagonist*A2 might be a risk factor for progressive vitiligo. PMID:29620037
  3. IL1-Ra is an independent predictor for adverse outcomes in patients with documented coronary artery disease. PMID:29395365
  4. Carrying allele IL1RN*2 had a strong association with idiopathic recurrent spontaneous abortion (iRSA) in Mexican women; this polymorphism codifies for a low-function protein, which may allow for increased activity of IL-1 pro-inflammatory axis in iRSA. PMID:29718011
  5. there was no sufficient evidence to support the association between IL-1RN 86-bp VNTR polymorphism and ischemic stroke (Meta-Analysis) PMID:30075593
  6. Serum interleukin 1 receptor antagonist (IL1RA) and granzyme B (GZMB) levels were markedly increased in Crohn's disease (CD) patients, suggesting that these markers can serve as biomarkers to identify gut inflammation. PMID:28972805
  7. this study reflects the importance of the IL1RN*2/2 genotype and its possible association in the pathogenesis of RA by regulation in the IL-1Ra production. PMID:29226727
  8. Data show that the frequency of the IL-1 receptor antagonist (IL-1RN) 'T' allele of rs928940 was significantly lower in BC cases than in controls. PMID:29047186
  9. TNF-alpha -857 C/C variant might represent protective effect against recurrent pregnancy loss (RPL) and the -857 C/T variant might be a genetic risk factor for the occurrence of RPL. Invariant differences in the prevalence of -511 C/T and -31 C/T polymorphisms and IL-1RN VNTR between RPL patients. PMID:29949333
  10. IL-1ra concentrations were greater (p = 0.0018) in bone marrow aspirate samples (13,432 pg/mL) than in platelet-rich plasma (588 pg/mL). PMID:26831858
  11. Studied role of IL-1Ra VNTR variant in susceptibility of temporomandibular joint disorders (TMD), and found the variant is significantly associated with TMD. PMID:28612927
  12. Studied interleukin-1 receptor antagonist (IL-1Ra) and angiotensin-converting enzyme (ACE) I/D polymorphisms with regards to the susceptibility of patients to carpal tunnel syndrome. PMID:28370589
  13. we did not observe an association between IL-1Ra 86 bp VNTR polymorphism in intron 2 and RPL patients (p > 0.05). Conclusion IL-1Ra VNTR polymorphism may not be a genetic factor for RPL PMID:28593919
  14. The presence of the rs2234663 A2/A2 genotype in rheumatoid arthritis is associated with increased disease activity. PMID:28342152
  15. The results suggest that although the 1068 G>A polymorphism of the P2RX7 gene is associated with an increased beta-cell function and IL-1Ra release in type 2 diabetes patients, the glycemic control is not significantly affected by the presence of this SNP. PMID:29425823
  16. Studies used adult stem cells to engineer anatomically shaped, functional cartilage constructs capable of tunable and inducible expression of antiinflammatory molecules, specifically IL-1 receptor antagonist (IL-1Ra). PMID:27432980
  17. No significant associations with RHD were found for the IL1RN rs447713 and CTLA4 rs3087243 SNPs. PMID:27400406
  18. Reconstitution of ST2 (IL-1R4) specific for IL-33 activity; no suppression by IL-1Ra though a common chain IL-1R3 (IL-1RAcP) shared with IL-1 PMID:27031441
  19. The polymorphic expression of IL-1RN (rs419598) gene may be associated with a reduced susceptibility to GAgP and GCP in populations of European descent. PMID:29023524
  20. associations between the genetic variants and the LPS-induced IL-6, IL-8, IL-10, IL-1ra and TNF-alpha cytokine levels were not significant in the meta-analysis. This present study does not support a strong genetic effect of LPS-stimulated cytokine production; however, the potential for type II errors should be considered PMID:23823136
  21. IL1RA intron 2 VNTR seems to be a genetic marker for overall adiposity status in Malaysian subjects. PMID:28293435
  22. Increased IL-1Ra levels in women with polycystic ovary syndrome were largely explained by increasing adiposity. However, serum IL-1Ra concentrations predicted 2-h glucose levels independently of BMI suggesting that increased IL-1Ra may be associated with disturbed glucose metabolism. PMID:27061312
  23. demonstrated that IL-1RN VNTR polymorphism might increase the risk of H. pylori infection, especially in Asians PMID:28384207
  24. VNTR polymorphism associated with osteomyelitis development PMID:28682145
  25. Polymorphisms of Il1rn were not significantly associated with bipolar I disorder in Iranian patients. PMID:28129679
  26. Meta-analysis: Serum IL-1RA levels were positively associated with risk of cardiovascular disease. This association may at least partially reflect a response to triggers inducing subclinical inflammation, oxidative stress, and endothelial activation. PMID:28428221
  27. Our work highlights the convenience and efficiency of this novel pH-sensitive fluorescent probe and reveals the new biological activity of staurosporine as an agonist for GLUT4 translocation and as an effective insulin additive analogue. PMID:27769857
  28. African American women are at increased risk for early birth, particularly via the inflammatory pathway. Variants of the IL1RN gene, which encode the interleukin-1 receptor antagonist (IL-1Ra) protein, are implicated in early birth PMID:28252571
  29. This study reveled that the association of IL1RN haplotype containing RN2 with FIRES, and showed a possible association of IL1RN rs4251981 G > A. PMID:27538648
  30. We found that the mean mRNA levels of the proinflammatory cytokines IL-1beta, IL-6, TNF-alpha, their receptors, TNFR1, TNFR2, IL-1R1 and the antagonist IL-1RA were significantly increased in the lymphocytes of MDD patients compared with NC [normal control subjects].. PMID:27138824
  31. C/T genotype of IL-1Ra +2018 prognosticates more aggressive disease in RA PMID:27105431
  32. this study shows that IL-1Ra gene variants are associated with susceptibility to juvenile idiopathic arthritis in Iranian population PMID:27717726
  33. The A2 allele of the interleukin 1 receptor antagonist VNTR polymorphism could be a protective factor for pre-eclampsia susceptibility. PMID:26555681
  34. A2 allele and the combined IL-4 (low) -IL-1Ra (high) genotype might be genetic markers of susceptibility to frailty in Mexican elderly. PMID:26646252
  35. This study demonstrated that thr frequency of the IL-1Ra/C allele at position Mspa-I 11100 was decreased significantly and the IL-1Ra/T frequency was significantly increased in patients with Febrile Seizures. PMID:26500244
  36. Data indicate that levels of interleukin 1 receptor antagonist protein (IL-1-Ra) remain elevated for at least one year after storage at -80 degrees C. PMID:26994310
  37. study showed that, IL-1RN allele 2, periodontal disease characterized with clinical attachment loss, previous preterm/low birth weight outcome (PLBW) and age could be important risk factors for PLBW PMID:26445016
  38. Significant associations were found between Crohn's disease (CD) and minor NOD2 variants, as well as TLR4 299Gly, TNF-alpha G-308A, IL-6 G-174C and IL-1RN VNTR A2 variants, while ulcerative colitis (UC) was associated only with IL-1RN VNTR A2 variants. PMID:26316104
  39. Suggest that IL-1RN rs315952 polymorphism may not be associated with susceptibility to Tourette syndrome in Chinese Han population. PMID:26097611
  40. Serum IL1RA and IL2RA are predictors of event free survival in T-cell lymphoma. PMID:26487586
  41. IL-1Ra can be a useful tool in the diagnosis of hepatic inflammation. PMID:26612588
  42. This study shows a significant association between IL-1 RA allele distribution and febrile convulsions PMID:26813462
  43. IL-1 genotypes do not seem to be good predictors of peri-implantitis in the great majority of smoking patients PMID:26449434
  44. the lower expression of IL10 and the higher expression of IL1RA in Mo exposed to arthritic than to non-arthritic SF suggest that arthritic SF is mainly reducing the inflammatory responses in Mo. PMID:26521731
  45. Results indicate there is a lack of association between the IL1RN VNTR polymorphisms and tuberculosis risk. [Meta-Analysis] PMID:26330006
  46. The IL-4 rs79071878 polymorphism, was associated whereas the IL-1Ra rs2234663 polymorphism was not associated with Familial Mediterranean Fever risk in the Turkish population. PMID:26861613
  47. While both contributing to pathogen clearance, NLRP3 more than NLRC4 contributes to deleterious inflammatory responses in cystic fibrosis and correlates with defective NLRC4-dependent IL-1Ra production. PMID:26972847
  48. These data suggest that M. leprae upregulates IL-1Ra by a TOLLIP-dependent mechanism; inhibition of TOLLIP may decrease an individual's susceptibility to leprosy and offer a novel therapeutic target for IL-1-dependent diseases. PMID:26610735
  49. This study emphasizes a positive association between IL1-Ra (VNTR) polymorphism and DM among Saudi children. This may suggest that (A2) allele may play important role in disease susceptibility. PMID:26502861
  50. IL1-RN VNTR A1A3 genotype is associated with higher risk of RA. Among the cases, males who carry this genotype were more exposed to RA and had less erosive forms. PMID:26003199

Show More

Hide All

Subcellular Location
[Isoform 1]: Secreted.; [Isoform 2]: Cytoplasm.; [Isoform 3]: Cytoplasm.; [Isoform 4]: Cytoplasm.
Tissue Specificity
The intracellular form of IL1RN is predominantly expressed in epithelial cells.
Database Links

HGNC: 6000

UNIGENE: Hs.81134

KEGG: hsa:3557

STRING: 9606.ENSP00000259206

OMIM: 147679

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products