Recombinant Human Transforming growth factor beta-3 (TGFB3)(Y340F), partial (Active)

In Stock
Code: CSB-AP004051HU
Size:
10ug
10ug50ug500ug1mg
US$290
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: Tag-Free
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human TGFB3 protein (Y340F), partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 0.01 EU/µg as determined by LAL method.
Activity
The ED50 as determined by its ability to inhibit the IL-4-dependent proliferation of TF-1 mouse T cells is 10-80 pg/ml.
Target Names
TGFB3
Uniprot NO.
Research Area
Cancer
Alternative Names
ARVD; ARVD1; FLJ16571; LDS5; MGC105479; MGC118722; prepro-transforming growth factor beta-3; RNHF; TGF beta 3; TGF beta3; TGF-beta-3; TGFB 3; Tgfb3; TGFB3_HUMAN; transforming growth factor beta 3; Transforming growth factor beta-3
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
301-412aa(Y340F)
Target Protein Sequence
ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
12.7 kDa
Protein Length
Partial
Tag Info
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered solution of 50mM Glycine-HCl, 150mM NaCl, pH2.5.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description

The Y340F point mutation in this TGF-β3 construct enables researchers to dissect structure-function relationships at a specific residue within the mature signaling domain (aa 301–412), providing a precise tool for receptor-ligand binding studies and competition assays using SPR or ELISA. Validated with an ED50 of 10–80 pg/mL in inhibiting IL-4-dependent TF-1 cell proliferation, this protein demonstrates potent bioactivity appropriate for cell proliferation and survival assays, stem cell or osteogenic differentiation studies, and in vivo tumor biology models. Mammalian cell expression preserves native-like glycosylation and folding critical for TGF-β3 receptor engagement, while the tag-free format eliminates potential interference in sensitive functional readouts. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the quality criteria typical for cell-based assays and downstream in vivo applications in cancer research.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Transforming growth factor beta-3 proprotein: Precursor of the Latency-associated peptide (LAP) and Transforming growth factor beta-3 (TGF-beta-3) chains, which constitute the regulatory and active subunit of TGF-beta-3, respectively.; Required to maintain the Transforming growth factor beta-3 (TGF-beta-3) chain in a latent state during storage in extracellular matrix. Associates non-covalently with TGF-beta-3 and regulates its activation via interaction with 'milieu molecules', such as LTBP1 and LRRC32/GARP, that control activation of TGF-beta-3. Interaction with integrins results in distortion of the Latency-associated peptide chain and subsequent release of the active TGF-beta-3.; Transforming growth factor beta-3: Multifunctional protein that regulates embryogenesis and cell differentiation and is required in various processes such as secondary palate development. Activation into mature form follows different steps: following cleavage of the proprotein in the Golgi apparatus, Latency-associated peptide (LAP) and Transforming growth factor beta-3 (TGF-beta-3) chains remain non-covalently linked rendering TGF-beta-3 inactive during storage in extracellular matrix. At the same time, LAP chain interacts with 'milieu molecules', such as LTBP1 and LRRC32/GARP that control activation of TGF-beta-3 and maintain it in a latent state during storage in extracellular milieus. TGF-beta-3 is released from LAP by integrins: integrin-binding results in distortion of the LAP chain and subsequent release of the active TGF-beta-3. Once activated following release of LAP, TGF-beta-3 acts by binding to TGF-beta receptors (TGFBR1 and TGFBR2), which transduce signal.
Gene References into Functions
  1. Elevations of TGF-beta3, SMAD2 and SMAD4 in hypertrophic scars and increase of IGF-1R in immature stages may give some clues for acne hypertrophic scar formation. PMID:30167815
  2. This review highlights advances in the understanding of the cellular sources, activation processes, contextual determinants, and immunological roles of TGF-beta3 with comparisons to other TGF-beta isoforms. PMID:30071700
  3. This study showed that YOD1 overexpression enhances cell migration by promoting TGF-beta3 signaling which may play an important role in lip and palate formation. PMID:30145984
  4. We suggest that increased TGFbeta3 levels are responsible for development of aggressive prostate cancer in African American patients as a consequence of development of resistance to inhibitory effects of TGFbeta on cell proliferation and induction of invasive metastatic behavior PMID:29474521
  5. data implies that miR-140 is a potent chondrogenic differentiation inducer for iPSCs and also, we have showed increasing chondrogenic differentiation by using overexpression of miR-140 and TGFbeta3. PMID:29456027
  6. The increase in TGF-beta3 found in inflammatory wound healing (WF) highlights its negative effect on wound healing, while the increased levels of sEng in granulating WF affects the leukocyte adhesion/transmigration through the endothelium, reducing the inflammatory response and favoring the wound healing. PMID:29065449
  7. In nonsyndromic CL+/-P Malay patients,the prevalence of the mutations in the TGFbeta3 gene was 17.7%. For the TGFbeta3 gene, there was no mutation in the coding region in either of the groups. PMID:26151095
  8. Human dental apical papilla-derived Mesenchymal stem cells (hSCAPs) can produce and secrete TGFbeta3 in response to micro-environmental cues. PMID:25690385
  9. Higher TGF-beta3 serum concentrations are a risk factor for uterine fibroids. PMID:27743697
  10. High expression of TGF-beta3 in preeclampsia decidua stimulates miR-494 in decidual mesenchymal stem cells (MSC) and attenuates the regulation of MSC switching the macrophage toward M2 type, contributing to an immune imbalance at maternal-fetal interface. PMID:27149081
  11. The frequency GA genotype of transforming growth factor beta 3 (TGFbeta3) gene was associated with increased risk of non-syndromic cleft palate only (NS CPO). PMID:28364787
  12. combining TGF-beta3 with BMP-2 was able to promote the process of bone formation more markedly in vitro, providing a promising clinical strategy in the field of skeletal regeneration and in fracture healing. PMID:27878265
  13. No significant association was observed in MMP13, TIMP2 and TGFB3 genes with CP or PI. CP is a risk factor to develop PI, however, there is no association of both diseases with polymorphisms in the MMP13, TIMP2 and TGFB3 genes PMID:27058373
  14. Our study showed that TGFA/TGFB3/MSX1 gene polymorphisms were associated with congenital NSHI. CCGTAC and TTACGT haplotypes might be protective factors, while TTGCGC haplotype might be a risk factor for congenital NSHI. TGFA/TGFB3/MSX1 gene rs3771494, rs1058213, rs3917201, rs2268626, rs3821949, and rs62636562 haplotype analysis showed that haplotype CCGTAC and TTACGT might be protective factors (both P<0.001) PMID:27356075
  15. increased stromal POSTN induced by TGF-beta3 directly accelerated the growth, migration and invasion of cancer cells PMID:26857387
  16. Taken together, these results demonstrate that insulin and TGF-beta3 present antagonistic effects during the chondrogenesis of human bone marrow-derived stem/progenitor cells. PMID:26866713
  17. CCN4 has a positive influence on chondrogenic differentiation by modulating the effects of TGF-beta3. PMID:26555637
  18. TGFB3 polymorphism is associated with male infertility. PMID:26612435
  19. Results identified a novel human TGFB3 mutation, which contributes to the clinical delineation of the emerging connective tissue disorder tentatively called Rienhoff syndrome, a disorder overlapping with Marfan and Loeys-Dietz syndrome. PMID:26184463
  20. Fluocinolone Acetonide enhances TGF-beta3-associated chondrogenesis of bone marrow derived mesenchymal stem cells PMID:25753754
  21. TGF-beta3-expressing CD4+CD25(-)LAG3+ regulatory T cells have a role in controlling humoral immune responses PMID:25695838
  22. TGF-beta3 mediates the attenuating effect of MSCs on both the proliferation and extracellular matrix production of human keloid fibroblasts and decreases skin fibrosis PMID:25858630
  23. TGF-beta3 existed in synovium and LBs of SC, and was responsible for the pathogenesis of SC. PMID:25742744
  24. TGFB3 polymorphism, significant differences were observed for allele and genotype frequencies between caries free and caries affected individuals in oral cleft group (p = 0.013 and 0.006 for allele and genotype frequencies respectively). PMID:25307808
  25. TGF-beta3 may contribute to the persistent intestinal dysfunction seen in gastroschisis-related intestinal dysfunction. PMID:25431043
  26. Data indicate greater staining for transforming growth factor beta 3 (TGF-beta3) in healthier tissue compared with diseased menisci. PMID:25418724
  27. The results show an intricate interplay between p53 and TGF-beta3 whereby p53 inhibits the TGF-beta3-induced expression of genes, e.g., EPHB2, to impede tumor cell invasion and migration PMID:25257729
  28. findings emphasize the broad clinical variability associated with TGFB3 mutations and highlight the importance of early recognition of the disease because of high cardiovascular risk PMID:25835445
  29. It was found that the majority of TGF-beta3 that was loaded onto the scaffold was released in a controlled manner over the first 10days of culture, with comparable long-term chondrogenesis PMID:24907658
  30. We identified genetic variants in TGFB3 and ARHGAP29 associated with suboptimal healing outcome. PMID:24635173
  31. These results unequivocally demonstrate that human TGF-beta3 elicits bone induction by up-regulation of endogenous BMP-2 and is blocked by hNoggin. PMID:24438909
  32. TGF-beta3 could be stably expressed in pcDNA3.1(+)-hTGF-beta3-transfected PSCs. PMID:21823016
  33. Liarozole decreased TGF-beta3 and TGF-beta3-mediated extracellular matrix expression in a 3D uterine leiomyoma culture system. PMID:24825427
  34. meta-analysis suggests that TGF-beta3 gene polymorphisms may contribute to NSCLP susceptibility, especially among Asian populations. PMID:24053560
  35. Allelic and haplotypic associations implicate a possible role of TGFB3 in nonsyndromic cleft lip with or without cleft palate in the Chilean population. PMID:20170386
  36. This study provides a comprehensive list of genes differentially expressed in the healing corneal epithelial cells of diabetic corneas and suggests the therapeutic potential of TGF-beta3 for treating corneal and skin wounds in diabetic patients. PMID:24306208
  37. The GG genotype and G allele of TGF-beta 3 were significantly different in the patient group compared with the control. PMID:23023602
  38. Shear stress of vascular endothelial cells induces TGF-beta3 signaling and subsequent activation of Kruppel-like factor 2 and NO, and represents a novel role for TGF-beta3 in the maintenance of homeostasis in a hemodynamic environment. PMID:23968981
  39. Mutation in TGFB3 is associated with a syndrome of low muscle mass, growth retardation, distal arthrogryposis and clinical features overlapping with Marfan and Loeys-Dietz syndrome. PMID:23824657
  40. These findings suggest human serum, FGF-2 and TGF-beta3 as possible candidates to support biological treatment strategies of AF defects. PMID:23122986
  41. These results highlight TGFbeta/5-HT signaling as a potent mechanism for control of biomechanical remodeling of atrioventricular cushions during development. PMID:22880017
  42. Hypoxia may inhibit the invasion of human extravillous trophoblast cells through inducing the integrin switch from alpha1 integrin to alpha5 integrin and promoting TGFB3 expression. PMID:22674391
  43. IL-1B & TGFB3 synergistically activated MMP)-1, MMP-3,& MMP-10 gene expression in NSCLC cells via MAPK-dependent pathways. PMID:22796605
  44. Significant statistical differences were found for genotype frequencies between tooth agenesis and TGFB3 control samples, as well as for allele and genotype frequencies between unilateral tooth agenesis and TGFB3 control samples. PMID:22191848
  45. TGF-beta3 isoform is a key agent in seminal plasma that signals induction of proinflammatory cytokine synthesis in cervical cells. PMID:22706080
  46. analysis of genetic variants hints at the contribution of TGFB3 and MN1 in the aetiology of submucous cleft palate PMID:22409215
  47. involved in the modulation of epithelial barrier function by regulating assembly of tight junctions PMID:22369552
  48. This study confirms the crucial role of TGF-beta3 in the fusion of palatal shelves during development and further, provides novel evidence of TGF-beta3 gene polymorphism in the etiology of nonsyndromic cleft lip and palate in Indian subpopulation PMID:22143699
  49. We observed significant downregulation of Transforming Growth Factor beta 3 in women with recurrent miscarriage compared with controls. PMID:22266274
  50. study suggests that both combination medium, but better with the addition of TGF-ss3 could enhance BMSCs chondrogenesis in vivo, and promotes themaintenance of the chondrocyte phenotype PMID:21666950

Show More

Hide All

Subcellular Location
[Latency-associated peptide]: Secreted, extracellular space, extracellular matrix.; [Transforming growth factor beta-3]: Secreted.
Protein Families
TGF-beta family
Database Links

HGNC: 11769

UNIGENE: Hs.592317

KEGG: hsa:7043

STRING: 9606.ENSP00000238682

OMIM: 107970

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products