Abbreviation
Recombinant Human FGF1 protein (Active)
Purity
>95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine balb/c 3T3 cells is less than 0.5 ng/ml, corresponding to a specific activity of >2.0x106 IU/mg in the presence of 10 μg/ml of heparin.
Alternative Names
Acidic fibroblast growth factor; aFGF; Beta endothelial cell growth factor; Beta-endothelial cell growth factor; ECGF; ECGF beta; ECGF-beta; ECGFA; ECGFB; Endothelial Cell Growth Factor alpha; Endothelial Cell Growth Factor beta; FGF 1; FGF alpha; Fgf1; FGF1_HUMAN; FGFA; Fibroblast Growth Factor 1 Acidic; Fibroblast growth factor 1; GLIO703; HBGF 1; HBGF-1; HBGF1; Heparin binding growth factor 1; Heparin binding growth factor 1 precursor; Heparin-binding growth factor 1
Species
Homo sapiens (Human)
Expression Region
16-155aa
Target Protein Sequence
M+FNLPPGNYK KPKLLYCSNG GHFLRILPDG TVDGTRDRSD QHIQLQLSAE SVGEVYIKST ETGQYLAMDTDGLLYGSQTPNEECLFLERL EENHYNTYIS KKHAEKNWFV GLKKNGSCKR GPRTHYGQKA ILFLPLPVSS D
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 µm filtered PBS, pH 7.4
Lead Time
5-10 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Datasheet & COA
Please contact us to get it.
Description
FGF1 is a uniquely promiscuous member of the FGF family, capable of binding all four FGF receptor subtypes, making it an essential tool for receptor-ligand binding studies, including SPR and competition ELISAs, as well as broad angiogenesis and tumor biology models. This tag-free recombinant human FGF1, covering the full mature sequence (residues 16–155), demonstrates exceptional potency with an ED50 below 0.5 ng/ml in balb/c 3T3 proliferation assays—corresponding to a specific activity exceeding 2.0 × 10⁶ IU/mg in the presence of heparin—which supports use in cell proliferation and survival assays, neuronal differentiation studies, and wound healing models requiring reliable mitogenic stimulation. Because FGF1 is natively non-glycosylated, *E. coli* expression yields a protein that is structurally faithful to the endogenous form without the batch-to-batch glycan variability sometimes introduced by mammalian systems. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for sensitive *in vivo* tumor xenograft experiments and primary cell culture work.
