Abbreviation
Recombinant Human FGF1 protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is 0.2-2 ng/ml.
Research Area
Signal Transduction
Alternative Names
Acidic fibroblast growth factor; aFGF; Beta endothelial cell growth factor; Beta-endothelial cell growth factor; ECGF; ECGF beta; ECGF-beta; ECGFA; ECGFB; Endothelial Cell Growth Factor alpha; Endothelial Cell Growth Factor beta; FGF 1; FGF alpha; Fgf1; FGF1_HUMAN; FGFA; Fibroblast Growth Factor 1 Acidic; Fibroblast growth factor 1; GLIO703; HBGF 1; HBGF-1; HBGF1; Heparin binding growth factor 1; Heparin binding growth factor 1 precursor; Heparin-binding growth factor 1
Species
Homo sapiens (Human)
Expression Region
16-155aa
Target Protein Sequence
FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered 20mM PB, 20% Trehalose, 100mM NaCl, 0.05% Tween 80, pH6.0.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Datasheet & COA
Please contact us to get it.
Description
FGF1 drives mitogenic signaling through all four FGF receptor subtypes, making it uniquely versatile among FGF family members for receptor-ligand binding studies, including SPR and competition ELISAs. This tag-free recombinant human FGF1, covering the full mature protein (aa 16–155), demonstrates potent bioactivity with an ED50 of 0.2–2 ng/mL in BALB/c 3T3 proliferation assays, confirming its suitability for cell proliferation and survival experiments, neuronal or osteogenic differentiation protocols, and angiogenesis or wound healing models. Because FGF1 is not glycosylated in its native form, E. coli expression yields a protein that is structurally authentic while maintaining cost-effective production at high yield. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for sensitive cell-based assays and supports use as a reliable standard in antibody characterization workflows.