Home
Product
Protein
Active Protein
Chemokine
Recombinant Human C-X-C motif chemokine 3 (CXCL3) (Active)

Recombinant Human C-X-C motif chemokine 3 (CXCL3) (Active)

Discontinued

Code: CSB-AP003551HU

Rate （N/A）
Review （0）

Size:

10ug50ug500ug1mg(1mg*1 or 500ug*2)

US$204

Quantity:

Express system: E.coli

Species: Homo sapiens (Human)

Tag Info: N-terminal 6xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Activity

The ED50 as determined by its ability to activate chimeric receptor and induce reporter gene expression in HEK293 cell line used Splite TEV activity detection platform is typically 80 ng/mL.

Target Names

CXCL3

Uniprot NO.

P19876

Research Area

Immunology

Alternative Names

C-X-C motif chemokine 3; C-X-C motif chemokine ligand 3; Chemokine (C X C motif) ligand 3; Chemokine (CXC motif) ligand 3; Cinc 2; CINC 2b; Cinc2; CINC2b; CXCL 3; Cxcl3; CXCL3_HUMAN; Cytokine induced neutrophil chemoattractant 2; Dcip1; Dendritic cell inflammatory protein 1; Gm1960; GRO protein gamma; GRO-gamma; GRO-gamma(1-73); GRO-gamma(5-73); GRO3; GRO3 oncogene; GROG; Growth regulated protein gamma; Growth-regulated protein gamma; Macrophage inflammatory protein 2 beta precursor ; Macrophage inflammatory protein 2-beta; Melanoma growth stimulatory activity gamma; Member 3; MGSA gamma; MIP 2b; MIP2-beta; MIP2B; SCYB3; Small inducible cytokine subfamily B

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

35-107aa

Target Protein Sequence

ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

10.1 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

Lyophilized from a 0.2 μm filtered solution of PBS,pH 7.4.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Ligand for CXCR2. Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. In vitro, the processed form GRO-gamma(5-73) shows a fivefold higher chemotactic activity for neutrophilic granulocytes.

Gene References into Functions

CXCL3 exerts its carcinogenic potential by directly and/or indirectly regulating the downstream signaling pathways and the expression of transcription factors in PCa. PMID:29524043
Exogenous CXCL3 induced Erk1/2 and ETS1 phosphorylation and promoted CD133 expression. PMID:27255419
Our findings suggest that CXCL3 and its receptor CXCR2 are overexpressed in prostate cancer cells, prostate epithelial cells and prostate cancer tissues, which may play multiple roles in prostate cancer progression and metastasis. PMID:26837773
results support a functional role of CXCL3 in breast cancer metastasis and as a viable target for cancer therapy PMID:24605943
CXCL3 displays antimicrobial activity against E. coli and S. aureus. PMID:12949249
secreted growth-regulated oncogene chemokines, specifically GRO-gamma, in human Mesenchymal stromal cell-conditioned media have an effect on the differentiation and the function of human monocyte-derived dendritic cells. PMID:23589610
Data show that mesenchymal stem cells (MSCs) directly regulate T cell proliferation by induction of CXCL3 chemokine and its receptor, CXCR2 on the surface in T cells. PMID:23023221
demonstrates, for the first time, that BIRC3 (anti-apoptotic protein), COL3A1 (matrix protein synthesis), and CXCL3 (chemokine) were up-regulated in the thrombin-stimulated human umbilical vein endothelial cells PMID:16356540
GRO-gamma is a promising candidate for Th2-associated glomerular permeability factor in minimal change disease. PMID:17389786
Inhibition of ERK phosphorylation decreased expression of GRO3. PMID:17466952
Report gonadotropin-releasing hormone-regulated CXCL3 expression in human placentation. PMID:19369450
propose that chemokines belonging to the CXC family could play an important role in the etiology of tendon xanthoma (TX), with CXCL3 being a possible biological marker of onset and development of TX PMID:19448742
overexpression of CXCL13 in the intestine during inflammatory conditions favors mobilization of B cells and of LTi and NK cells with immunomodulatory and reparative functions. PMID:19741597