Home
Product
Protein
Active Protein
Tumor Necrosis Factor
Recombinant Rabbit Tumor necrosis factor (TNF), partial (Active)

Recombinant Rabbit Tumor necrosis factor (TNF), partial (Active)

In Stock

Code: CSB-AP005051RB

Rate （N/A）
Review （0）

Size:

10ug50ug500ug1mg

US$226

Quantity:

Express system: E.coli

Species: Oryctolagus cuniculus (Rabbit)

Tag Info: Tag-Free

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Abbreviation

Recombinant Rabbit TNF protein, partial (Active)

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Activity

The ED50 as determined in a cytotoxicity assay using L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D is 3.5 pg/ml.

Uniprot NO.

P04924

Research Area

Cancer

Alternative Names

TNF; TNFA; TNFSF2; Tumor necrosis factor; Cachectin; TNF-alpha; Tumor necrosis factor ligand superfamily member 2; TNF-a

Species

Oryctolagus cuniculus (Rabbit)

Source

E.coli

Expression Region

78-235aa

Target Protein Sequence

VTLRSASRALSDKPLAHVVANPQVEGQLQWLSQRANALLANGMKLTDNQLVVPADGLYLIYSQVLFSGQGCRSYVLLTHTVSRFAVSYPNKVNLLSAIKSPCHRETPEEAEPMAWYEPIYLGGVFQLEKGDRLSTEVNQPEYLDLAESGQVYFGIIAL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

17.59 kDa

Protein Length

Partial

Tag Info

Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

Lyophilized from a 0.2 μm filtered 20mM PB, 250mM NaCl, pH 7.4.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Description

Rabbit TNF-α drives potent cytotoxicity with an ED50 of 3.5 pg/ml in the L-929/actinomycin D assay, confirming exceptional signaling activity that supports use in NF-κB and MAPK pathway activation studies, apoptosis assays, and species-matched in vivo tumor biology models. This tag-free recombinant protein encompasses the mature extracellular domain (aa 78–235), preserving native receptor-binding topology critical for accurate functional readouts. Endotoxin levels below 1.0 EU/μg eliminate LPS-driven artifacts in immune cell assays, making this preparation appropriate for TNF-α-dependent macrophage activation experiments, antibody development as an immunogen or ELISA standard, and cytotoxicity dose-response characterization. Purity exceeding 95% by SDS-PAGE, combined with the low endotoxin burden, satisfies the quality thresholds commonly required for sensitive cell-based functional studies where unambiguous attribution of biological effects to TNF-α is essential.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Induces insulin resistance in adipocytes via inhibition of insulin-induced IRS1 tyrosine phosphorylation and insulin-induced glucose uptake. Induces GKAP42 protein degradation in adipocytes which is partially responsible for TNF-induced insulin resistance. Plays a role in angiogenesis by inducing VEGF production synergistically with IL1B and IL6.; The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells.

Gene References into Functions

TUNEL staining was positively correlated with TNF-a protein expression. Our findings suggest that apoptosis can be induced in the vocal fold epithelium after 120min of modal intensity phonation. In contrast, shorter durations of vibration exposure do not result in apoptosis signaling. PMID:27577014
Inflammatory factors such as TNF-alpha can stimulate MMP-2/9 activity in corneal epithelium cells. This may be a potential manipulating mechanism of MMP expression in the pathogenesis of corneal diseases. PMID:26125840
The JNK pathway plays an important role in mechanical ventilation-stimulated TNF-alpha expression in alveolar macrophages, but the injury-stimulated IL-8 expression may be regulated by other signaling pathways. PMID:24070709
The TNFalpha-evoked Cl- current. PMID:24084720
IL-1beta and TNF-alpha expression increases significantly during acute lung injury. Ambroxol combined with low-dose heparin inhibits teh release of IL-1beta and TNF-alpha. PMID:21845882
Hypercapnia increased expression of TNFa and decreased expression of NFKB in acute lung injury models. PMID:21158126
In the early stages of myocardial ischemia, bone marrow stem cells are mobilized and home to ischemic myocardium with a concomitant increase in expression of cytokines VEGF and TNFalpha. PMID:20624659
Ammonium perchlorate can increase gene expressions of types I, III collagens, TGF-beta(1) and TNF-alpha in lung of rabbits. PMID:20937628
TNFalpha may either be directly or indirectly involved in vascular damage following an embolic stroke. Moreover, TNFalpha may mediate some of the detrimental effects of tPA on the vascular compartment PMID:17673188

Hide All

Subcellular Location

Cell membrane; Single-pass type II membrane protein.; [Tumor necrosis factor, membrane form]: Membrane; Single-pass type II membrane protein.; [Tumor necrosis factor, soluble form]: Secreted.; [C-domain 1]: Secreted.; [C-domain 2]: Secreted.

Protein Families

Tumor necrosis factor family

Database Links

UNIGENE: Ocu.1971

KEGG: ocu:100009088

STRING: 9986.ENSOCUP00000005787

Promotions