Home
Product
Protein
Active Protein
Tumor Necrosis Factor
Recombinant Human Tumor necrosis factor receptor superfamily member 10C (TNFRSF10C), partial (Active)

Recombinant Human Tumor necrosis factor receptor superfamily member 10C (TNFRSF10C), partial (Active)

In Stock Discontinued

Code: CSB-AP004981HU

Rate （N/A）
Review （0）

Size:

10ug50ug500ug1mg(1mg*1 or 500ug*2)

US$96

Quantity:

Express system: Mammalian cell

Species: Homo sapiens (Human)

Tag Info: C-terminal 6xHis-hFc-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Activity

The ED50 as determined by its ability to inhibit TRAIL-mediated cytotoxicity using L?929 mouse fibroblast cells treated with TRAIL is typically 450 ng/mL.

Uniprot NO.

O14798

Research Area

Cancer

Alternative Names

TNFRSF10C; DCR1; LIT; TRAILR3; TRID; UNQ321/PRO366; Tumor necrosis factor receptor superfamily member 10C; Antagonist decoy receptor for TRAIL/Apo-2L; Decoy TRAIL receptor without death domain; Decoy receptor 1; DcR1; Lymphocyte inhibitor of TRAIL; TNF-related apoptosis-inducing ligand receptor 3; TRAIL receptor 3; TRAIL-R3; TRAIL receptor without an intracellular domain; CD antigen CD263

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

26-221aa

Target Protein Sequence

ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

48.7 kDa

Protein Length

Partial

Tag Info

C-terminal 6xHis-hFc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for the cytotoxic ligand TRAIL. Lacks a cytoplasmic death domain and hence is not capable of inducing apoptosis. May protect cells against TRAIL mediated apoptosis by competing with TRAIL-R1 and R2 for binding to the ligand.

Gene References into Functions

High levels of TRAIL-R3 and CCR-2 expression in tumor epithelial cells identified patients with early breast cancer with poor outcomes. PMID:28420351
DcR1 levels in serum sample which were significantly lower in AMD patients. PMID:24534820
DcR1 upregulation mediates temozolomide resistance. PMID:25808868
GATA4 and DcR1 promoter hypermethylation is tumor specific event in glioblastoma but they promoter methylation cannot be considered as a prognostic marker of glioblastoma survival. PMID:23320456
Primary EOC is associated to a lower TRAIL-R3 expression. PMID:22555108
Data show that about 20% of AML patients highly expressed decoy receptor TRAIL-R3, which was strongly correlated to a shortened overall survival. PMID:21281967
Decoy receptors DcR1 and DcR2 on CD8+ T cells, but not on CD4-positive T cells, are positively correlated with patients' DAS scores. PMID:20799941
Results suggest that DcR1 expression occurs in a subset of endometrial carcinomas and may contribute to resistance to TRAIL-induced apoptosis. PMID:19936781
analysis of the transcription initiation sites and promoter structure of the TRAIL-R3 gene PMID:12417331
cloned and characterized a p53 consensus element located within the first intron of the TRAIL-R3 gene PMID:14623878
Our results demonstrate that DcR1 and DcR2 genes are frequently methylated in various tumor types, and aberrant methylation was the cause for silencing of DcR1 and DcR2 expression. PMID:14999791
The DcR1 had no death domain and was anchored to the membrane via a glycophosphatidyl inositol tail. PMID:15538968
Resistance to TRAIL-induced apoptosis in acute myeloid leukemia cells is associated with expression of TRAIL-R3. PMID:15921376
tryptophol induces apoptosis through DR5 and the resistance of PBL to tryptophol-induced apoptosis might be due to competition from DcR1 PMID:17690453
p53 negatively regulates oxaliplatin-mediated TRAIL-induced apoptotic activity through DcR1 upregulation. PMID:18345033
TRAILR3 (TNF-related apoptosis inducing ligand receptor 3) levels were significantly higher in lung parenchyma in subjects with emphysema PMID:18511705
Liver metastases with low DcR1/TNFRSF10C mRNA expression were more likely to present with extrahepatic metastases PMID:18590575
inactivation of TNFRSF10C by chromosomal deletion and promoter methylation may play an important role in prostate cancer development PMID:19035483
Low DCR1 is associated with non-small cell lung cancer. PMID:19661294

Hide All

Subcellular Location

Cell membrane; Lipid-anchor, GPI-anchor.

Tissue Specificity

Higher expression in normal tissues than in tumor cell lines. Highly expressed in peripheral blood lymphocytes, spleen, skeletal muscle, placenta, lung and heart.

Database Links

HGNC: 11906

UNIGENE: Hs.655801

KEGG: hsa:8794

STRING: 9606.ENSP00000349324

OMIM: 603613

Promotions