CHHRLCHCSNGVFLCQDSKVTEMPSDLPRDAVELRFVLTKLRVIPEGAFSGFGDLEKIEI SQNDVLEVIEANVFSNLPKLHEIRIEKANNLLYIDPDAFQNLPNLRYLLISNTGIKHLPA VHKIQSLQKVLLDIQDNINIHTVERNSFMGLSFESMIVWLSKNGIQEIHNCAFNGTQLDE LNLSDNSNLEELPNDVFQGASGPVILDISRTRIRSLPSYGLENLKKLRAKSTYHLKKLPS LEKFVTLVEASLTYPSHCCAFANWRRQTSDLHPICNKSILRQEVDDMTQARGQRISLAED DEPSYAKGFDMMYSEFDYDLCSEVVDVTCSPEPDAFNPCEDIMGYDILRVLIWFISILAI TGNILVLVILITSQYKLTVPRFLMCNLAFADLCIGIYLLLIASVDVHTKSQYHNYAIDWQ TGAGCDAAGFFTVFASELSVYTLTAITLERWHTITHAMQLECKVHVRHAASIMLVGWVFA FAVALFPIFGISSYMKVSICLPMDIDSPLSQLYVMSLLVLNVLAFVVICGCYTHIYLTVR NPNITSSSSDTKIAKRMAMLIFTDFLCMAPISFFAISASLKVPLITVSKSKILLVLFYPI NSCANPFLYAIFTRNFRRDFFILLSKFGCYEVQAQTYRSETSFTAHNFHPRNGHCPPAPR VTNGSNYTLIPLRHLAKN
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
G protein-coupled receptor for follitropin, the follicle-stimulating hormone. The activity of isoform FSH-R1 is mediated by G proteins which activate adenylate cyclase. Isoform FSH-R2 and isoform FSH-R3 also bind FSH, but this does not result in activation of adenylate cyclase. Isoform FSH-R3 may be involved in calcium signaling. Through cAMP production activates the downstream PI3K-AKT and ERK1/ERK2 signaling pathways.
Gene References into Functions
BB mutation-induced attenuation of BMPR1B signaling led to an increased density of the FSH receptor and LH receptor and a concurrent reduction in apoptosisPMID:25948249
Combined effect analyses indicated an extremely significant interaction between the random combinations of BMPR-IB, BMP-15 and FSHR genes on litter size.PMID:25993301
molecular cloning and characterization results identified a synonymous mutation in the ovine FSHR gene to be significantly associated with the litter size.PMID:25103022
Single nucleotide polymorphisms of 5' regulatory region of follicle-stimulating hormone receptor (FSHR) gene were detected in two high prolificacy sheep breeds and two low prolificacy sheep breeds.PMID:21725846