Recombinant Sheep Follicle-stimulating hormone receptor (FSHR)

Code: CSB-CF009021SH
Size:
20μg
20μg100μg
US$7568
Quantity:
Express system: in vitro E.coli expression system
Species: Ovis aries (Sheep)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
FSHR
Uniprot NO.
Alternative Names
FSHR; Follicle-stimulating hormone receptor; FSH-R; Follitropin receptor
Species
Ovis aries (Sheep)
Source
in vitro E.coli expression system
Expression Region
18-695
Target Protein Sequence
CHHRLCHCSNGVFLCQDSKVTEMPSDLPRDAVELRFVLTKLRVIPEGAFSGFGDLEKIEI SQNDVLEVIEANVFSNLPKLHEIRIEKANNLLYIDPDAFQNLPNLRYLLISNTGIKHLPA VHKIQSLQKVLLDIQDNINIHTVERNSFMGLSFESMIVWLSKNGIQEIHNCAFNGTQLDE LNLSDNSNLEELPNDVFQGASGPVILDISRTRIRSLPSYGLENLKKLRAKSTYHLKKLPS LEKFVTLVEASLTYPSHCCAFANWRRQTSDLHPICNKSILRQEVDDMTQARGQRISLAED DEPSYAKGFDMMYSEFDYDLCSEVVDVTCSPEPDAFNPCEDIMGYDILRVLIWFISILAI TGNILVLVILITSQYKLTVPRFLMCNLAFADLCIGIYLLLIASVDVHTKSQYHNYAIDWQ TGAGCDAAGFFTVFASELSVYTLTAITLERWHTITHAMQLECKVHVRHAASIMLVGWVFA FAVALFPIFGISSYMKVSICLPMDIDSPLSQLYVMSLLVLNVLAFVVICGCYTHIYLTVR NPNITSSSSDTKIAKRMAMLIFTDFLCMAPISFFAISASLKVPLITVSKSKILLVLFYPI NSCANPFLYAIFTRNFRRDFFILLSKFGCYEVQAQTYRSETSFTAHNFHPRNGHCPPAPR VTNGSNYTLIPLRHLAKN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
G protein-coupled receptor for follitropin, the follicle-stimulating hormone. The activity of isoform FSH-R1 is mediated by G proteins which activate adenylate cyclase. Isoform FSH-R2 and isoform FSH-R3 also bind FSH, but this does not result in activation of adenylate cyclase. Isoform FSH-R3 may be involved in calcium signaling. Through cAMP production activates the downstream PI3K-AKT and ERK1/ERK2 signaling pathways.
Gene References into Functions
  1. BB mutation-induced attenuation of BMPR1B signaling led to an increased density of the FSH receptor and LH receptor and a concurrent reduction in apoptosis PMID:25948249
  2. Combined effect analyses indicated an extremely significant interaction between the random combinations of BMPR-IB, BMP-15 and FSHR genes on litter size. PMID:25993301
  3. molecular cloning and characterization results identified a synonymous mutation in the ovine FSHR gene to be significantly associated with the litter size. PMID:25103022
  4. Single nucleotide polymorphisms of 5' regulatory region of follicle-stimulating hormone receptor (FSHR) gene were detected in two high prolificacy sheep breeds and two low prolificacy sheep breeds. PMID:21725846

Show More

Hide All

Subcellular Location
[Isoform FSH-R1]: Cell membrane; Multi-pass membrane protein.; [Isoform FSH-R2]: Cell membrane; Multi-pass membrane protein.; [Isoform FSH-R3]: Cell membrane; Single-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family, FSH/LSH/TSH subfamily
Tissue Specificity
Isoform FSH-R3 is expressed in ovary and testis, but not in kidney (at protein level).
Database Links

UNIGENE: Oar.372

KEGG: oas:443299

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products