Recombinant Rat T-cell surface antigen CD2 (Cd2)

Code: CSB-CF004894RA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4904

Quantity:

Express system: in vitro E.coli expression system

Species: Rattus norvegicus (Rat)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Cd2

Uniprot NO.

P08921

Alternative Names

Cd2; T-cell surface antigen CD2; LFA-2; LFA-3 receptor; OX-34 antigen; T-cell surface antigen T11/Leu-5; CD antigen CD2

Species

Rattus norvegicus (Rat)

Source

in vitro E.coli expression system

Expression Region

23-344

Target Protein Sequence

RDSGTVWGALGHGINLNIPNFQMTDDIDEVRWERGSTLVAEFKRKMKPFLKSGAFEILANGDLKIKNLTRDDSGTYNVTVYSTNGTRILDKALDLRILEMVSKPMIYWECSNATLTCEVLEGTDVELKLYQGKEHLRSLRQKTMSYQWTNLRAPFKCKAVNRVSQESEMEVVNCPEKGLPLYLIVGVSAGGLLLVFFGALFIFCICKRKKRNRRRKGEELEIKASRMSTVERGPKPHSTQASAPASQNPVASQAPPPPGHHLQTPGHRPLPPSHRNREHQPKKRPPPSGTQVHQQKGPPLPRPRVQPKPPCGSGDVSLPPPN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

CD2 interacts with lymphocyte function-associated antigen CD58 (LFA-3) and CD48/BCM1 to mediate adhesion between T-cells and other cell types. CD2 is implicated in the triggering of T-cells, the cytoplasmic domain is implicated in the signaling function.

Gene References into Functions

At temperatures above approx 68 degrees C, a partially folded state of CD2-1 (H state) with a distinct secondary structure, involving largely exposed aromatic and hydrophobic residues and a substantially perturbed tertiary structure, is observed. PMID:11939369
Structural biology of the cell adhesion protein CD2: alternatively folded states and structure-function relation. Review. PMID:12369898
Data show that designed cyclic peptides with beta-turn structure have the ability to modulate the CD2-CD58 interaction, which is critical for an immune response. PMID:15233784

Hide All

Subcellular Location

Cell membrane; Single-pass type I membrane protein.

Database Links

UNIGENE: Rn.10328

KEGG: rno:497761

STRING: 10116.ENSRNOP00000021268

Promotions