Recombinant Rat Relaxin receptor 1 (Rxfp1)

Code: CSB-CF744175RA
Size:
20μg
20μg100μg
US$8166
Quantity:
Express system: in vitro E.coli expression system
Species: Rattus norvegicus (Rat)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Rxfp1
Uniprot NO.
Alternative Names
Rxfp1; Lgr7; Relaxin receptor 1; Leucine-rich repeat-containing G-protein coupled receptor 7; Relaxin family peptide receptor 1
Species
Rattus norvegicus (Rat)
Source
in vitro E.coli expression system
Expression Region
1-758
Target Protein Sequence
MTSGPFFFCVFIIGRYFTLGNAQDVSCPLGSFPCGNISKCLPQLLHCNGVDDCGNQADED NCGDNNGWSLQLDKYFANYYKLTSTNSIEAETSECLVGSVPMHCLCRDLELDCDEANLRA VPSVSSNVTVMSLQWNFIRTLPPNSFRKYHDLQKLCLQNNKIRSVSVSAFRGLHSLTKLY LSHNRITFLKPGVFEDLHRLEWLIIEDNHLSRISPLTFYGLNSLILLVLMNNALTRLPDK PLCQHMPRLHWLDFEGNRIHNLRNLTFISCNNLTVLVMRKNKINHLNEHAFTHLQKLDEL DLGSNKIENLPPNIFKDLKELSQLNISYNPIQKIEVNQFDYLAKLKSLSLEGIEISNIQQ RMFRPLINLSHIYFKKFQYCGYAPHVRSCKPNTDGISSLENLLASIIQRVFVWVVSAITC FGNIFVICMRPYIRSENKLHAMSIMSLCCADCLMGVYLFVIGAFDLKFRGEYRKHAQPWM ESVHCQFMGSLAVLSTEVSVLLLTFLTLEKYICIVYPFRCLRPRKCRTVAVLIFIWITGF IVAFAPLGNKEFFKNYYGTNGVCFPLHSEDTGSTGAQIYSVVIFLGINLVAFIIIVFSYG SMFYSVHQSTITATEIQKQVKKEMILAKRFFFIVFTDALCWIPIFILKFLSLIRVEIPDT ITSWVVIFILPINSALNPIIYTLTTRPFKEMIHQLWYNYRQRRSVDRKGTQKAYTPSFIW VEMWPLQEMSTEFMKPDAFTDPCDLSLVSRSSRLNSYS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for relaxins. The activity of this receptor is mediated by G proteins leading to stimulation of adenylate cyclase and an increase of cAMP. Binding of the ligand may also activate a tyrosine kinase pathway that inhibits the activity of a phosphodiesterase that degrades cAMP.
Gene References into Functions
  1. Data indicate that knee passive range of motion (ROM), relaxin receptor isoforms Rxfp1 and Rxfp2 expression were significantly reduced following treatment with testosterone, and androgen antagonist flutamide antagonized the testosterone effect. PMID:24642882
  2. RXFP1 & RXFP2 up-regulation by progesterone and estrogen could provide the basis for the reported increase in knee laxity while down-regulation of these receptor isoforms by testosterone could explain low incidence of non-contact knee injury in male. PMID:24465164
  3. RXFP1 was predominantly localized to the tunica media vascular smooth muscle cells in the uterine artery. Highest expression of Rxfp1 in the uterine artery occurred in estrus and early pregnancy. PMID:22744867
  4. H3 relaxin exerts antifibrotic actions via RXFP1 receptor PMID:21229994
  5. investigation of expression of RXFP1 in myometrium during gestation; the down-regulation of RXFP1 expression that occurs in late gestation correlates well with progesterone withdrawal PMID:20686183
  6. investigation of expression of RXFP1 in uterine tissues before, during, and after pregnancy; fetal-placental unit appears involved in regulation of expression of RXFP1; down-regulation of RXFP1 expression occurs in late gestation PMID:20686184
  7. Uncovered is a pre-assembled, constitutively active G-protein-coupled receptor signalosome, that couples the relaxin receptor, relaxin family peptide receptor 1 (RXFP1), to cAMP following receptor stimulation with sub-picomolar concentrations of peptide. PMID:20664520
  8. mouse and rat LGR7 are the relaxin receptors in these species PMID:15566402
  9. Mouse and rat LGR7 were able to bind to and be activated by relaxin ligands PMID:15956680
  10. LGR7-Truncate is potentially an endogenous regulator of LGR7 signaling PMID:15956683
  11. both LGR7 and LGR8 are expressed in activated hepatic stellate cells and cirrhotic liver PMID:15956705
  12. High densities of LGR7 mRNA hybridization were detected in deep layers of neocortex, hypothalamic paraventricular and supraoptic nuclei and within hippocampal subiculum and CA3, the basolateral amygdala and subfornical organ PMID:15956709
  13. Leucine-rich-repeat-containing G-protein-coupled receptor-7 mRNA was expressed by neurons in several brain regions, including the olfactory bulb, cerebral cortex, thalamus, hippocampus, hypothalamus, midbrain, pons and medulla. PMID:16725278
  14. derivatives of LGR7 relaxin receptor have a dose dependent affect on the enyzymatic activity of relaxin-sensitive adenylate cyclase PMID:16776079
  15. Lgr7 and Lgr8 are upregulated in response to a reduction in uteroplacental blood flow in rats. PMID:17524297
  16. G-protein coupled receptor RXFP1, previously known as LGR7, is widely distributed throughout the male rat reproductive tract and may be important in regulation of spermatogenesis. PMID:17623071

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Detected in brain cortex, and at low levels in testis.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products