Recombinant Rat Relaxin receptor 1 (Rxfp1)

Code: CSB-CF744175RA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$8166

Quantity:

Express system: in vitro E.coli expression system

Species: Rattus norvegicus (Rat)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Rxfp1

Uniprot NO.

Q6R6I6

Alternative Names

Rxfp1; Lgr7; Relaxin receptor 1; Leucine-rich repeat-containing G-protein coupled receptor 7; Relaxin family peptide receptor 1

Species

Rattus norvegicus (Rat)

Source

in vitro E.coli expression system

Expression Region

1-758

Target Protein Sequence

MTSGPFFFCVFIIGRYFTLGNAQDVSCPLGSFPCGNISKCLPQLLHCNGVDDCGNQADED NCGDNNGWSLQLDKYFANYYKLTSTNSIEAETSECLVGSVPMHCLCRDLELDCDEANLRA VPSVSSNVTVMSLQWNFIRTLPPNSFRKYHDLQKLCLQNNKIRSVSVSAFRGLHSLTKLY LSHNRITFLKPGVFEDLHRLEWLIIEDNHLSRISPLTFYGLNSLILLVLMNNALTRLPDK PLCQHMPRLHWLDFEGNRIHNLRNLTFISCNNLTVLVMRKNKINHLNEHAFTHLQKLDEL DLGSNKIENLPPNIFKDLKELSQLNISYNPIQKIEVNQFDYLAKLKSLSLEGIEISNIQQ RMFRPLINLSHIYFKKFQYCGYAPHVRSCKPNTDGISSLENLLASIIQRVFVWVVSAITC FGNIFVICMRPYIRSENKLHAMSIMSLCCADCLMGVYLFVIGAFDLKFRGEYRKHAQPWM ESVHCQFMGSLAVLSTEVSVLLLTFLTLEKYICIVYPFRCLRPRKCRTVAVLIFIWITGF IVAFAPLGNKEFFKNYYGTNGVCFPLHSEDTGSTGAQIYSVVIFLGINLVAFIIIVFSYG SMFYSVHQSTITATEIQKQVKKEMILAKRFFFIVFTDALCWIPIFILKFLSLIRVEIPDT ITSWVVIFILPINSALNPIIYTLTTRPFKEMIHQLWYNYRQRRSVDRKGTQKAYTPSFIW VEMWPLQEMSTEFMKPDAFTDPCDLSLVSRSSRLNSYS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for relaxins. The activity of this receptor is mediated by G proteins leading to stimulation of adenylate cyclase and an increase of cAMP. Binding of the ligand may also activate a tyrosine kinase pathway that inhibits the activity of a phosphodiesterase that degrades cAMP.

Gene References into Functions

Data indicate that knee passive range of motion (ROM), relaxin receptor isoforms Rxfp1 and Rxfp2 expression were significantly reduced following treatment with testosterone, and androgen antagonist flutamide antagonized the testosterone effect. PMID:24642882
RXFP1 & RXFP2 up-regulation by progesterone and estrogen could provide the basis for the reported increase in knee laxity while down-regulation of these receptor isoforms by testosterone could explain low incidence of non-contact knee injury in male. PMID:24465164
RXFP1 was predominantly localized to the tunica media vascular smooth muscle cells in the uterine artery. Highest expression of Rxfp1 in the uterine artery occurred in estrus and early pregnancy. PMID:22744867
H3 relaxin exerts antifibrotic actions via RXFP1 receptor PMID:21229994
investigation of expression of RXFP1 in myometrium during gestation; the down-regulation of RXFP1 expression that occurs in late gestation correlates well with progesterone withdrawal PMID:20686183
investigation of expression of RXFP1 in uterine tissues before, during, and after pregnancy; fetal-placental unit appears involved in regulation of expression of RXFP1; down-regulation of RXFP1 expression occurs in late gestation PMID:20686184
Uncovered is a pre-assembled, constitutively active G-protein-coupled receptor signalosome, that couples the relaxin receptor, relaxin family peptide receptor 1 (RXFP1), to cAMP following receptor stimulation with sub-picomolar concentrations of peptide. PMID:20664520
mouse and rat LGR7 are the relaxin receptors in these species PMID:15566402
Mouse and rat LGR7 were able to bind to and be activated by relaxin ligands PMID:15956680
LGR7-Truncate is potentially an endogenous regulator of LGR7 signaling PMID:15956683
both LGR7 and LGR8 are expressed in activated hepatic stellate cells and cirrhotic liver PMID:15956705
High densities of LGR7 mRNA hybridization were detected in deep layers of neocortex, hypothalamic paraventricular and supraoptic nuclei and within hippocampal subiculum and CA3, the basolateral amygdala and subfornical organ PMID:15956709
Leucine-rich-repeat-containing G-protein-coupled receptor-7 mRNA was expressed by neurons in several brain regions, including the olfactory bulb, cerebral cortex, thalamus, hippocampus, hypothalamus, midbrain, pons and medulla. PMID:16725278
derivatives of LGR7 relaxin receptor have a dose dependent affect on the enyzymatic activity of relaxin-sensitive adenylate cyclase PMID:16776079
Lgr7 and Lgr8 are upregulated in response to a reduction in uteroplacental blood flow in rats. PMID:17524297
G-protein coupled receptor RXFP1, previously known as LGR7, is widely distributed throughout the male rat reproductive tract and may be important in regulation of spermatogenesis. PMID:17623071